4 results match your criteria: "Institute of Physical Organic Chemistry of the National Academy of Sciences of Belarus[Affiliation]"

Spectroscopic studies on domains and peptides of large proteins are complicated because of the tendency of short peptides to form oligomers in aquatic buffers, but conjugation of a peptide with a carrier protein may be helpful. In this study we approved that a fragment of SK30 peptide from phospholipase A2 domain of VP1 Parvovirus B19 capsid protein (residues: 144-159; 164; 171-183; sequence: SAVDSAARIHDFRYSQLAKLGINPYTHWTVADEELLKNIK) turns from random coil to alpha helix in the acidic medium only in case if it had been conjugated with BSA (through additional N-terminal Cys residue, turning it into CSK31 peptide, and SMCC linker) according to CD-spectroscopy results. In contrast, unconjugated SK30 peptide does not undergo such shift because it forms stable oligomers connected by intermolecular antiparallel beta sheet, according to IR-spectroscopy, CD-spectroscopy, blue native gel electrophoresis and centrifugal ultrafiltration, as, probably, the whole isolated phospholipase domain of VP1 protein does.

View Article and Find Full Text PDF

Microplastics (MPs) in sludge can affect the ability of biochar-activated peroxymonosulfate (PMS) to degrade antibiotics. In this work, biochar was prepared by mixing sludge and polystyrene (PS) through hydrothermal carbonization (HTC) and high-temperature pyrolysis processes. The resulting biochar was used to activate PMS to degrade ofloxacin (OFX), levofloxacin (LEV), and pefloxacin (PFX).

View Article and Find Full Text PDF

Simulation of microbial aging biochar in compost is an important index for evaluating the biochar degradation efficiency of antibiotics. In this study, biochar was prepared by adding microplastics (MPs) to sludge, and the degradation effect of biochar/(peroxymonosulfate, PMS) on antibiotics was evaluated during the compost aging process of biochar. After the compost aging of biochars, the antibiotic degradation efficiency of HPBC500, HPBC500 + polystyrene (PS), HPBC900/PMS, and HPBC900 + PS/PMS decreased by 6.

View Article and Find Full Text PDF

For the first time, biochar was prepared by changing the polystyrene (PS) content in sludge, and the efficiency of antibiotics removal by biochar was evaluated after fermentation aging. Fermentation aging affects the efficiency of antibiotics removal by reducing the specific surface area and active sites of biochar. The antibiotics removal efficiency of different types of biochar after aging decreased by 5.

View Article and Find Full Text PDF