The Manduca sexta Malpighian tubule assay system, developed to monitor adenylate cyclase activity, was used in combination with HPLC to isolate a novel cAMP generating peptide from 350,000 whole flesh flies, Neobellieria bullata. Mass spectrometry revealed a molecular mass of 5,047 daltons, and Edman degradation the following sequence: AGAEAEKLSGLSKYFNGTTMAGRANVAKATYAVIGLIIAYNVMKPKKK. This 48-mer peptide, called Neb-cGP, does not belong to the corticotropin releasing factor family of insect diuretic peptides. Electrophoresis and subsequent immunoblotting of peptides immunoprecipitated from a homogenate of entire flies showed that one fly contained approximately 0.003 to 0.03 micrograms Neb-cGP and that 10 micrograms represents the lowest immunostainable amount on a Western blot.
Download full-text PDF |
Source |
|---|---|
| http://dx.doi.org/10.1002/(SICI)1520-6327(1996)31:2<135::AID-ARCH2>3.0.CO;2-Z | DOI Listing |
Publication Analysis
Top Keywords
Similar Publications
Impact of Magneto-Mechanical Actuation on Cell Differentiation: A Study Using Wireless, 3D-Printed Device and a Porous Ferrogel.
Small
January 2025
Department of Biosciences and Bioengineering, Indian Institute of Technology Roorkee, Roorkee, Uttarakhand, 247667, India.
Cells perceive external and internally generated forces of different kinds, significantly impacting their cellular biology. In the relatively nascent field of mechanobiology, the impact of such forces is studied and further utilized to broaden the knowledge of cellular developmental pathways, disease progression, tissue engineering, and developing novel regenerative strategies. However, extensive considerations of mechanotransduction pathways for biomedical applications are still broadly limited due to a lack of affordable technologies in terms of devices and simple magnetic actuatable materials.
View Article and Find Full Text PDFMalnutrition in spondylodiscitis: an overlooked risk factor.
J Orthop Surg Res
January 2025
Swedish Neuroscience Institute, Swedish Medical Center, Seattle 550 17th Avenue, Suite 500, Seattle, WA, 98122, USA.
Objective: Spondylodiscitis presents a significant diagnostic and treatment challenge to healthcare providers, with various risk factors and treatment outcomes having been identified. Malnutrition, a multifactorial condition defined by imbalance or deficiency of nutrients, is a known risk factor for various adverse events such as postoperative infection and readmissions in spine surgery. However, its impact in SD has not yet been explored.
View Article and Find Full Text PDFLncRNA-MSTRG.19083.1 Targets NTRK2 as a miR-429-y Sponge to Regulate Circadian Rhythm via the cAMP Pathway in Yak Testis and Cryptorchidism.
Int J Mol Sci
December 2024
College of Veterinary Medicine, Gansu Agriculture University, Lanzhou 730070, China.
Long noncoding RNAs (LncRNAs) play essential roles in numerous biological processes in mammals, such as reproductive physiology and endocrinology. Cryptorchidism is a common male reproductive disease. Circadian rhythms are actively expressed in the reproductive system.
View Article and Find Full Text PDFTRAP-Induced Platelet Reactivity Is Inhibited by Omega-3 Fatty Acid-Derived Prostaglandin E3 (PGE3).
Biomedicines
December 2024
Department of Physiology, University of Murcia, 30120 Murcia, Spain.
Prostaglandins are naturally occurring local mediators that can participate in the modulation of the cardiovascular system through their interaction with Gs/Gi-coupled receptors in different tissues and cells, including platelets. Thrombin is one of the most important factors that regulates platelet reactivity and coagulation. Clinical trials have consistently shown that omega-3 fatty acid supplementation lowers the risk for cardiovascular mortality and morbidity.
View Article and Find Full Text PDFEffects of prenatal exposure to multiple heavy metals on infant neurodevelopment: a multi-statistical approach.
Environ Pollut
January 2025
Nutrition and Mental Health (NUTRISAM) research group, Universitat Rovira i Virgili, 43204 Reus, Spain; Institut d'Investigació Sanitaria Pere Virgili (IISPV), 43204 Reus, Spain; University Research Institute on Sustainability, Climate Change and Energy Transition (IU-RESCAT) Universitat Rovira i Virgili, 43003 Tarragona, Spain; Collaborative Research Group on Lifestyles, Nutrition and Smoking (CENIT). Tarragona-Reus Research Support Unit, Jordi Gol Primary Care Research Institute, 43003 Tarragona, Spain.
Prenatal exposure to heavy metals poses risks to fetal brain development, yet the joint effects of these metals remain unclear, with inconsistent findings across statistical models. This study investigates the joint effect of prenatal exposure to cadmium (Cd), nickel (Ni), mercury (Hg), and lead (Pb) on infant neurodevelopment using various statistical approaches. The study included 400 mother-infant pairs.
View Article and Find Full Text PDFWant AI Summaries of new PubMed Abstracts delivered to your In-box?
Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!