Our study was carried out in winegrowing in France and relates to the prevention of pesticide exposure situations. During treatments, the sprayer is a technical determinant directly responsible for these situations because of its design. The objective of our study is to gain a better understanding of pesticide exposure situations during the use of sprayers, by identifying the design of these machinery and the regulations that apply to it as a chain of determinants. Focusing on activity-centred ergonomics, this qualitative study formulates ergonomic (video recorded observations and interviews) and legal (content regulation) analyses at each level of this chain (treatments activities, sprayer design activities, regulation, and regulation development activities). The results highlight the role of design and regulation in the emergence of pesticide exposure situations, due to a little consideration of the real work of winegrowers. This means that design and regulation are relevant change levers for sustainable preventive action.
Download full-text PDF |
Source |
|---|---|
| http://dx.doi.org/10.1080/00140139.2024.2439923 | DOI Listing |
Publication Analysis
Top Keywords
Similar Publications
Structural and functional characterization of cellulose synthase proteins (CesA) in rice and their regulation via brassinosteroid signaling under arsenate stress.
Plant Cell Rep
December 2024
Department of Biotechnology, School of Bioengineering, SRM Institute of Science and Technology, Kattankulathur, Tamil Nadu, 603 203, India.
CesA proteins response to arsenic stress in rice involves structural and regulatory mechanisms, highlighting the role of BES1/BZR1 transcript levels under arsenate exposure and significant downregulation of BZR1 protein expression. Plants interact with several hazardous metalloids during their life cycle through root and soil connection. One such metalloid, is arsenic and its perilous impact on rice cultivation is a well-known threat.
View Article and Find Full Text PDFChronic Kidney Disease of Unknown Etiology: A Global Health Threat in Rural Agricultural Communities-Prevalence, Suspected Causes, Mechanisms, and Prevention Strategies.
Pathophysiology
December 2024
Laboratory of Epidemiology and Research in Health Sciences, Faculty of Medicine and Pharmacy, Sidi Mohammed Ben Abdellah University, PO 1893, Km 2200, Route Sidi Harazem, Fez 30000, Morocco.
Chronic Kidney Disease of Unknown Etiology (CKDu) is a worldwide hidden health threat that is associated with progressive loss of kidney functions without showing any initial symptoms until reaching end-stage renal failure, eventually leading to death. It is a growing health problem in Asia, Central America, Africa, and the Middle East, with identified hotspots. CKDu disease mainly affects young men in rural farming communities, while its etiology is not related to hypertension, kidney stones, diabetes, or other known causes.
View Article and Find Full Text PDFAnalysis of Thiodiphenol in Rat Urine as a Biomarker of Exposure to Temephos.
J Xenobiot
December 2024
Departamento de Toxicología, Centro de Investigación y de Estudios Avanzados del Instituto Politécnico Nacional (Cinvestav-IPN), Av. IPN 2508, Col. San Pedro Zacatenco, Ciudad de México 07360, Mexico.
Temephos is an organophosphorus pesticide widely used as a larvicide in public health campaigns to control vector-borne diseases. Data on the urinary elimination of temephos metabolites are limited, and there is no validated biomarker of exposure for its evaluation. This study aimed to determine the urinary excretion kinetics of temephos and its metabolites in adult male rats.
View Article and Find Full Text PDFAssessing the Influence of Low Doses of Sucrose on Memory Deficits in Fish Exposed to Common Insecticide Based on Fipronil and Pyriproxyfen.
Curr Issues Mol Biol
December 2024
Research and Development Station for Aquaculture and Aquatic Ecology, "Alexandru Ioan Cuza" University, Carol I, 20A, 700505 Iasi, Romania.
Although pesticides have been a constant concern for decades, in the last ten years, public discussions and scientific research have emphasized their impact on human health and the environment, drawing increased attention to the problems associated with their use. The association of environmental stressors such as pesticides with a sugar-rich diet can contribute to the growing global metabolic disease epidemic through overlapping mechanisms of insulin resistance, inflammation, and metabolic dysregulation. The main aim of this study was to evaluate the behavioral effects of the exposure of Silver crucian carp () to a commercial insecticide formulation containing fipronil, pyriproxyfen, and other additives, as well as sucrose and their mixtures.
View Article and Find Full Text PDFManaging tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide.
Front Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFWant AI Summaries of new PubMed Abstracts delivered to your In-box?
Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!