Objectives: The level of greenhouse farmers' personal protection in pesticide use and the possibility of environmental protection through farmers' willingness to reduce chemical sprayings were assessed in Khuzestan Province, Iran.

Methods: A survey of 80 active greenhouse vegetable growers was carried out in 2021 with face-to-face interviews. Willingness to reduce chemical sprayings was examined with the theory of planned behavior (TPB) model.

Results: Several intoxication symptoms were reported, with the most common symptom of pesticide intoxication being dizziness. Farmers showed unsafe or rather unsafe use of personal protective equipment (PPE) during pesticide handling. The maximum use of PPE pertained to the use of mask, spray clothing, and long-sleeved shirts. On a scale from 1 (= totally disagree) to 5 (= totally agree), the respondents showed negative attitudes towards reducing chemical sprayings (mean = 2.30), rather low levels of subjective norms (mean = 2.67), and rather low levels of perceived behavioral control over reduction of chemical sprayings (mean = 2.76). The TPB variables accounted for 73% of the variance in farmers' behavioral intention. Overall, farmers' behavioral intention to reduce chemical sprayings was almost neutral.

Conclusion: Increasing knowledge of the adverse effects of pesticides on health is necessary to promote safety behavior of farmers in the greenhouse.

Download full-text PDF

Source
http://dx.doi.org/10.1080/1059924X.2024.2413086DOI Listing

Publication Analysis

Top Keywords

chemical sprayings
24
reduce chemical
16
willingness reduce
12
personal protection
8
low levels
8
farmers' behavioral
8
behavioral intention
8
chemical
6
sprayings
6
occupational exposure
4

Similar Publications

<b>Background and Objective:</b> Prolonged utilization of chemical fertilizers can harm the soil and disturb the equilibrium of nutrients, resulting in a decline in cherry tomato yield. To enhance the growth of cherry tomato plants, it is necessary to add organic chemicals. The research aimed to determine the best elicitor biosaka concentration to apply to evoke the plant growth of cherry tomatoes (<i>Solanum lycopersicum</i> L.

View Article and Find Full Text PDF

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

View Article and Find Full Text PDF

Unlocking the role of silicon against biotic stress in plants.

Front Plant Sci

December 2024

Sugarcane Research Institute, Guangxi Academy of Agricultural Sciences/Key Laboratory of Sugarcane Biotechnology and Genetic Improvement, Ministry of Agriculture and Rural Affairs/Guangxi Key Laboratory of Sugarcane Genetic Improvement, Nanning, Guangxi, China.

The requirement for agricultural crops continues to enhance with the continuous growth of the human population globally. Plant pathogenic diseases outbreaks are enhancing and threatening food security and safety for the vulnerable in different regions worldwide. Silicon (Si) is considered a non-essential element for plant growth.

View Article and Find Full Text PDF

Background: Peanut stem rot, caused by Sclerotium rolfsii, has become increasingly prevalent in China, leading to significant yield losses in peanut production. To effectively manage peanut stem rot, we assessed the potential application of difenoconazole against peanut stem rot.

Results: Difenoconazole has a good inhibitory effect on the mycelial growth of S.

View Article and Find Full Text PDF

Background: Thrips are among the most damaging pests to cowpeas in Hainan, China. Conventional pesticide application methods often fail to achieve satisfactory control due to the small size and concealed habitats of thrips. This study aimed to enhance the efficacy of pesticides by improving their application techniques.

View Article and Find Full Text PDF

Want AI Summaries of new PubMed Abstracts delivered to your In-box?

Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!