Background: Continuous monocropping obstacles are common in plants, especially medicinal plants, resulting in disease outbreaks and productivity reductions. Foliar disease, mainly caused by Fusarium oxysporum, results in a severe decrease in the yield of Pseudostellaria heterophylla annually. Determining an effective biomethod to alleviate this disease is urgently needed to improve its productivity and quality.

Results: This study screened thirty-two keystone bacterial genera induced by pathogens in P. heterophylla rhizosphere soil under continuous monocropping conditions. Pseudomonas, Chryseobacterium, and Flavobacterium, referred to as the beneficial microbiota, were significantly attracted by pathogen infection. The P. palleroniana strain B-BH16-1 can directly inhibit the growth and spore formation of seven primary pathogens of P. heterophylla foliar disease by disrupting fusaric acid production via the emission of volatile organic compounds (VOCs). In addition, strain B-BH16-1 enhances the disease resistance of P. heterophylla by obliterating the pathogen and assembling beneficial microbiota.

Conclusion: Pathogen-induced Pseudomonas reshaped phyllosphere microbial communities via direct antagonism of pathogens and indirect disruption of the pathogen virulence factor biosynthesis to enhance disease suppression and improve yields. These results show that inhibiting pathogen virulence biosynthesis to reshape the plant microbial community using disease-induing probiotics will be an innovative strategy for managing plant disease, especially under continuous monoculture conditions.

Download full-text PDF

Source
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC11344943PMC
http://dx.doi.org/10.1186/s40793-024-00603-3DOI Listing

Publication Analysis

Top Keywords

foliar disease
12
pseudomonas reshaped
8
reshaped phyllosphere
8
pseudostellaria heterophylla
8
heterophylla foliar
8
disease
8
disease resistance
8
volatile organic
8
organic compounds
8
continuous monocropping
8

Similar Publications

Formal systems supporting the delivery of high-quality cassava seed are being established in several key cassava producing countries in Africa. Questions remain, however, about the value of certified cassava seed when compared to seed which is recycled multiple times, which is standard farmer practice. A study was therefore conducted to compare fresh cassava root yields of high-quality seed (HQS) versus farmer-saved (recycled) seed (FSS) for three widely grown improved cassava varieties in Tanzania namely: , and .

View Article and Find Full Text PDF

Background: Tomato (Solanum lycopersicum L) is affected by various diseases among which Orthotospovirus arachinecrosis cause huge economical loss to the farmers. Management of viral diseases using systemic insecticides will target the beneficial microflora and fauna besides polluting the environment and cause health hazards. In this context, inducing systemic resistance (ISR) through Bacillus spp.

View Article and Find Full Text PDF

Wheat ( spp.) is one of the most important cereal crops in the world. Several diseases affect wheat production and can cause 20-80% yield loss annually.

View Article and Find Full Text PDF

is one of the fungi that cause plant diseases. It damages plants by secreting large amounts of oxalic acid and cell wall-degrading enzymes. To meet this challenge, we designed a new pH/enzyme dual-responsive nanopesticide Pro@ZnO@Pectin (PZP).

View Article and Find Full Text PDF

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

View Article and Find Full Text PDF

Want AI Summaries of new PubMed Abstracts delivered to your In-box?

Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!