Background: Continuous monocropping obstacles are common in plants, especially medicinal plants, resulting in disease outbreaks and productivity reductions. Foliar disease, mainly caused by Fusarium oxysporum, results in a severe decrease in the yield of Pseudostellaria heterophylla annually. Determining an effective biomethod to alleviate this disease is urgently needed to improve its productivity and quality.
Results: This study screened thirty-two keystone bacterial genera induced by pathogens in P. heterophylla rhizosphere soil under continuous monocropping conditions. Pseudomonas, Chryseobacterium, and Flavobacterium, referred to as the beneficial microbiota, were significantly attracted by pathogen infection. The P. palleroniana strain B-BH16-1 can directly inhibit the growth and spore formation of seven primary pathogens of P. heterophylla foliar disease by disrupting fusaric acid production via the emission of volatile organic compounds (VOCs). In addition, strain B-BH16-1 enhances the disease resistance of P. heterophylla by obliterating the pathogen and assembling beneficial microbiota.
Conclusion: Pathogen-induced Pseudomonas reshaped phyllosphere microbial communities via direct antagonism of pathogens and indirect disruption of the pathogen virulence factor biosynthesis to enhance disease suppression and improve yields. These results show that inhibiting pathogen virulence biosynthesis to reshape the plant microbial community using disease-induing probiotics will be an innovative strategy for managing plant disease, especially under continuous monoculture conditions.
Download full-text PDF |
Source |
---|---|
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC11344943 | PMC |
http://dx.doi.org/10.1186/s40793-024-00603-3 | DOI Listing |
Crop Prot
January 2025
International Institute of Tropical Agriculture (IITA), Dar es Salaam, Tanzania, Box 34441, Dar es Salaam, Tanzania.
Formal systems supporting the delivery of high-quality cassava seed are being established in several key cassava producing countries in Africa. Questions remain, however, about the value of certified cassava seed when compared to seed which is recycled multiple times, which is standard farmer practice. A study was therefore conducted to compare fresh cassava root yields of high-quality seed (HQS) versus farmer-saved (recycled) seed (FSS) for three widely grown improved cassava varieties in Tanzania namely: , and .
View Article and Find Full Text PDFMol Biol Rep
December 2024
Department of Plant Breeding & Genetics, Tamil Nadu Agricultural University, Coimbatore, Tamil Nadu, 641 003, India.
Background: Tomato (Solanum lycopersicum L) is affected by various diseases among which Orthotospovirus arachinecrosis cause huge economical loss to the farmers. Management of viral diseases using systemic insecticides will target the beneficial microflora and fauna besides polluting the environment and cause health hazards. In this context, inducing systemic resistance (ISR) through Bacillus spp.
View Article and Find Full Text PDFFront Plant Sci
December 2024
Genebank Department, Leibniz Institute of Plant Genetics and Crop Plant Research (IPK), Seeland, Germany.
Wheat ( spp.) is one of the most important cereal crops in the world. Several diseases affect wheat production and can cause 20-80% yield loss annually.
View Article and Find Full Text PDFNanomaterials (Basel)
December 2024
College of Chemistry and Materials Science, Jinan University, Guangzhou 510632, China.
is one of the fungi that cause plant diseases. It damages plants by secreting large amounts of oxalic acid and cell wall-degrading enzymes. To meet this challenge, we designed a new pH/enzyme dual-responsive nanopesticide Pro@ZnO@Pectin (PZP).
View Article and Find Full Text PDFFront Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFEnter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!