Two Gram-stain-negative, facultatively aerobic, and motile rod bacteria, designated as strains KJ51-3 and 15G1-11, were isolated from marine algae collected in the Republic of Korea. Both strains exhibited catalase- and oxidase-positive activities. Optimum growth conditions for strain KJ51-3 were observed at 30 °C and pH 6.0-8.0, with 1.0-7.0 % (w/v) NaCl, whereas strain 15G1-11 exhibited optimal growth at 30 °C, pH 7.0, and 1.0-5.0 % NaCl. Major fatty acids detected in both strains included C, C 3-OH and summed features 3 (C 7 and/or C 6) and 8 (C 7 and/or C 6). As for polar lipids, strain KJ51-3 contained phosphatidylethanolamine (PE), phosphatidylglycerol (PG), diphosphatidylglycerol, and two unidentified phospholipids, whereas strain 15G1-11 had PE, PG, and an unidentified aminolipid. Ubiquinone-8 was the predominant respiratory quinone in both strains, with minor detection of ubiquinone-9 in strain KJ51-3. The genomic DNA G+C contents were 44.0 mol% for strain KJ51-3 and 40.5 mol% for strain 15G1-11. Phylogenetic analyses based on both 16S rRNA gene and genome sequences placed strains KJ51-3 and 15G1-11 into distinct lineages within the genus , most closely related to 328 (98.6 %) and SM1966 (98.3 %), respectively. Strains KJ51-3 and 15G1-11 exhibited a 94.6 % 16S rRNA gene sequence similarity and a 70.7 % average nucleotide identity (ANI), with ANI values of 91.9 and 79.3 % between them and 328 and SM1966, respectively, indicating that they represent novel species. In summary, based on their phenotypic, chemotaxonomic, and phylogenetic properties, strains KJ51-3 and 15G1-11 are proposed to represent novel species within the genus , for which the names sp. nov. (KJ51-3=KACC 22756=JCM 35591) and sp. nov. (15G1-11=KACC 22593=JCM 35412) are respectively proposed.
Download full-text PDF |
Source |
---|---|
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC11165874 | PMC |
http://dx.doi.org/10.1099/ijsem.0.006366 | DOI Listing |
Photochem Photobiol
December 2024
Graduate School of Informatics, Nagoya University, Nagoya, Japan.
Circadian clocks facilitate organisms' adaptation to the day-night environmental cycle. Some of the component genes of the clocks ("clock genes") respond directly to changes in ambient light, supposedly allowing the clocks to synchronize to and/or oscillate robustly in the environmental cycle. In the dicotyledonous model plant Arabidopsis thaliana, the clock genes CIRCADIAN CLOCK ASSOCIATED 1 (CCA1), LATE ELONGATED HYPOCOTYL (LHY) and PSEUDO-RESPONSE REGULATOR 9 (PRR9) show transient expression in response to the morning light.
View Article and Find Full Text PDFYing Yong Sheng Tai Xue Bao
October 2024
College of Natural Resources and Environment, Northwest A&F University/Key Laboratory of Plant Nutrition and Agri-environment in Northwest China, Ministry of Agriculture and Rural Affairs, Yangling 712100, Shaanxi, China.
Inoculating zinc solubilizing microorganisms (ZSMs) is considered as a promising strategy for increasing Zn phytoavailability in soils with low Zn availability. In present study, we screened six strains of ZSMs from rhizosphere of green manure crop, including three strains of fungi, , and three strains of bacteria, . We conducted a pot experiment of Bok choy inoculated with different ZSMs to analyze the Zn content in shoots and roots, and compared the Zn solubilizing effect of ZSMs.
View Article and Find Full Text PDFFront Bioeng Biotechnol
December 2024
Department of Biotechnology and Biosciences, University of Milano-Bicocca, Milan, Italy.
Polyethylene (PE) is the most-produced polyolefin, and consequently, it is the most widely found plastic waste worldwide. PE biodegradation is under study by applying different (micro)organisms in order to understand the biodegradative mechanism in the majority of microbes. This study aims to identify novel bacterial species with compelling metabolic potential and strategic genetic repertoires for PE biodegradation.
View Article and Find Full Text PDFFront Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFFront Microbiol
December 2024
College of Food Science and Engineering, Qingdao Agricultural University, Qingdao, China.
Sour meat is a popular traditional fermented product and is a rich source of novel strains with probiotic potential. In this study, we aimed to assess the probiotic potential of lactic acid bacteria (LAB) strains isolated from fermented sour meat. Firstly, the microbial diversity of sour meat from four different areas in China was analyzed.
View Article and Find Full Text PDFEnter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!