Exogenous addition of IAA has the potential to improve the metal tolerance and phytostabilization of plants, but these effects have not been systematically investigated in naturally tolerant plants. Ryegrass ( L.) is a typical indigenous plant in the Lanping Pb/Zn mining area with high adaptability. This study investigated the phytostabilization ability and Pb tolerance mechanism of ryegrass in response to Pb, with or without foliar spraying of 0.1 mmol L IAA. The results indicated that appropriate IAA treatment could be used to enhance the phytostabilization efficiency of naturally tolerant plants. Foliar spraying of IAA increased the aboveground and belowground biomass of ryegrass and improved root Pb phytostabilization. Compared to Pb-treated plants without exogenous IAA addition, Pb concentration in the shoots of ryegrass significantly decreased, then increased in the roots after the foliar spraying of IAA. In the 1,000 mg kg Pb-treated plants, Pb concentration in the shoots decreased by 69.9% and increased by 79.1% in the roots after IAA treatment. IAA improved plant growth, especially in soils with higher Pb concentration. Foliar spraying of IAA increased shoot biomass by 35.9% and root biomass by 109.4% in 1,000 mg kg Pb-treated plants, and increased shoot biomass by 196.5% and root biomass by 71.5% in 2,000 mg kg Pb-treated plants. In addition, Pb stress significantly decreased the content of photosynthetic pigments and anti-oxidase activities in ryegrass, while foliar spraying of IAA remedied these negative impacts. In summary, foliar spraying of IAA could increase the biomass and improve the Pb tolerance of ryegrass.

Download full-text PDF

Source
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC10726742PMC
http://dx.doi.org/10.7717/peerj.16560DOI Listing

Publication Analysis

Top Keywords

foliar spraying
28
spraying iaa
20
pb-treated plants
16
iaa
12
naturally tolerant
12
plant growth
8
tolerant plants
8
iaa treatment
8
iaa increased
8
concentration shoots
8

Similar Publications

Crop plants are severely affected by heavy metals (HMs), leading to food scarcity and economical loss. Lead (Pb) is outsourced by use of lead-based fertilizers, batteries, mining, smelting and metal processing. It significantly reduces growth, development and yield of crops cultivated on contaminated sites.

View Article and Find Full Text PDF

An experiment was performed at the Banaras Hindu University, India to study the effect of terminal heat stress on photosynthetic dynamics and fluorescence parameters of wheat genotypes and ameliorative effects of epibrassinolide by taking two genotypes with four concentrations as foliar spray at two growth stages of wheat. The highest values were observed in plots foliar sprayed with 1.0 µM 24-epibrassinolide (T1) under normal conditions (D1) where the genotype Sonalika (V1) performed significantly well w.

View Article and Find Full Text PDF

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

View Article and Find Full Text PDF

Unlocking the role of silicon against biotic stress in plants.

Front Plant Sci

December 2024

Sugarcane Research Institute, Guangxi Academy of Agricultural Sciences/Key Laboratory of Sugarcane Biotechnology and Genetic Improvement, Ministry of Agriculture and Rural Affairs/Guangxi Key Laboratory of Sugarcane Genetic Improvement, Nanning, Guangxi, China.

The requirement for agricultural crops continues to enhance with the continuous growth of the human population globally. Plant pathogenic diseases outbreaks are enhancing and threatening food security and safety for the vulnerable in different regions worldwide. Silicon (Si) is considered a non-essential element for plant growth.

View Article and Find Full Text PDF

Efficacy and Fate of RNA Interference Molecules in the Green Pea Aphid, Acyrthosiphon pisum.

Arch Insect Biochem Physiol

December 2024

Biological Control of Insects Research Laboratory, Research Park, USDA Agricultural Research Service, Columbia, Missouri, USA.

RNA interference (RNAi) is a promising technology for controlling insect pests of agriculture. This technology is mediated through the application of double-stranded RNAs (dsRNAs), which are processed within the insect cells into small interfering RNAs (siRNAs). These molecules then target and reduce the expression of the insect-specific genes that can kill or reduce the performance of the pest.

View Article and Find Full Text PDF

Want AI Summaries of new PubMed Abstracts delivered to your In-box?

Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!