Plants have developed an adaptive strategy for coping with biotic or abiotic stress by recruiting specific microorganisms from the soil pool. Recent studies have shown that the foliar spraying of pesticides causes oxidative stress in plants and leads to changes in the rhizosphere microbiota, but the mechanisms by which these microbiota change and rebuild remain unclear. Herein, we provide for the first-time concrete evidence that rice plants respond to the stress of application of the insecticide chlorpyrifos (CP) by enhancing the release of amino acids, lipids, and nucleotides in root exudates, leading to a shift in rhizosphere bacterial community composition and a strong enrichment of the genus sp. In order to investigate the underlying mechanisms, we isolated a representative isolate and demonstrated that it is both attracted by and able to consume linolenic acid, one of the root exudates overproduced after pesticide application. We further show that this strain selectively colonizes roots of treated plants and alleviates pesticide stress by degrading CP and releasing plant-beneficial metabolites. These results indicate a feedback loop between plants and their associated microbiota allowing to respond to pesticide-induced stress.
Download full-text PDF |
Source |
---|---|
http://dx.doi.org/10.1021/acs.est.3c04593 | DOI Listing |
Sci Rep
December 2024
College of Agriculture and Biotechnology, Zhejiang University, Hangzhou, 310058, China.
Crop plants are severely affected by heavy metals (HMs), leading to food scarcity and economical loss. Lead (Pb) is outsourced by use of lead-based fertilizers, batteries, mining, smelting and metal processing. It significantly reduces growth, development and yield of crops cultivated on contaminated sites.
View Article and Find Full Text PDFSci Rep
December 2024
Department of Plant Physiology, Institute of Agricultural Sciences, Banaras Hindu University, BHU Varanasi, 221005, Uttar Pradesh, India.
An experiment was performed at the Banaras Hindu University, India to study the effect of terminal heat stress on photosynthetic dynamics and fluorescence parameters of wheat genotypes and ameliorative effects of epibrassinolide by taking two genotypes with four concentrations as foliar spray at two growth stages of wheat. The highest values were observed in plots foliar sprayed with 1.0 µM 24-epibrassinolide (T1) under normal conditions (D1) where the genotype Sonalika (V1) performed significantly well w.
View Article and Find Full Text PDFFront Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFFront Plant Sci
December 2024
Sugarcane Research Institute, Guangxi Academy of Agricultural Sciences/Key Laboratory of Sugarcane Biotechnology and Genetic Improvement, Ministry of Agriculture and Rural Affairs/Guangxi Key Laboratory of Sugarcane Genetic Improvement, Nanning, Guangxi, China.
The requirement for agricultural crops continues to enhance with the continuous growth of the human population globally. Plant pathogenic diseases outbreaks are enhancing and threatening food security and safety for the vulnerable in different regions worldwide. Silicon (Si) is considered a non-essential element for plant growth.
View Article and Find Full Text PDFArch Insect Biochem Physiol
December 2024
Biological Control of Insects Research Laboratory, Research Park, USDA Agricultural Research Service, Columbia, Missouri, USA.
RNA interference (RNAi) is a promising technology for controlling insect pests of agriculture. This technology is mediated through the application of double-stranded RNAs (dsRNAs), which are processed within the insect cells into small interfering RNAs (siRNAs). These molecules then target and reduce the expression of the insect-specific genes that can kill or reduce the performance of the pest.
View Article and Find Full Text PDFEnter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!