Bacterial wilt disease caused by is a widespread, severe plant disease. Tomato (), one of the most important vegetable crops worldwide, is particularly susceptible to this disease. Biological control offers numerous advantages, making it a highly favorable approach for managing bacterial wilt. In this study, the results demonstrate that treatment with the biological control strain R31 significantly reduced the incidence of tomato bacterial wilt. In addition, R31 directly inhibits the growth of , and lipopeptides play an important role in this effect. The results also show that R31 can stably colonize the rhizosphere soil and root tissues of tomato plants for a long time, reduce the population in the rhizosphere soil, and alter the microbial community that interacts with . This study provides an important theoretical basis for elucidating the mechanism of as a biological control agent against bacterial wilt and lays the foundation for the optimization and promotion of other agents such as R31.
Download full-text PDF |
Source |
|---|---|
| http://www.ncbi.nlm.nih.gov/pmc/articles/PMC10568012 | PMC |
| http://dx.doi.org/10.3389/fmicb.2023.1281381 | DOI Listing |
Publication Analysis
Top Keywords
Similar Publications
Metagenomic Sequencing of Tomato Plants with Wilt Symptoms Allows for Strain-Level Pathogen Identification and Genome-Based Characterization.
Phytopathology
January 2025
Virginia Polytechnic Institute and State University, School of Plant and Environmental Science, Blacksburg, Virginia, United States;
Diseases that affect the vascular system or the pith are of great economic impact since they can rapidly destroy the affected plants, leading to complete loss in production. Fast and precise identification is thus important to inform containment and management, but many identification methods are slow because they are culture-dependent and they do not reach strain resolution. Here we used culture-independent long-read metagenomic sequencing of DNA extracted directly from stems of two tomato samples that displayed wilt symptoms.
View Article and Find Full Text PDFExploring sp. M21F004 for Biocontrol of Bacterial and Fungal Phytopathogens.
Mar Drugs
November 2024
Department of Agricultural Chemistry, Institute of Environmentally Friendly Agriculture, College of Agriculture and Life Sciences, Chonnam National University, Gwangju 61186, Republic of Korea.
This study explores the biocontrol potential of sp. M21F004, a lactic acid bacteria (LAB) isolated from marine environments, against several bacterial and fungal phytopathogens. Out of 50 marine bacterial isolates, sp.
View Article and Find Full Text PDFManaging tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide.
Front Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFCytokinin Plays a Multifaceted Role in Ralstonia solanacearum-Triggered Plant Disease Development.
Mol Plant Pathol
December 2024
State Key Laboratory of Crop Stress Resistance and High-Efficiency Production, College of Agronomy, Northwest A&F University, Yangling, China.
Cytokinin signalling plays both positive and negative roles in plant resistance to pathogens. It is not clear whether the role of cytokinin changes at the different stages of pathogen infection. Arabidopsis thaliana sequentially exhibits distinct root morphological symptoms during Ralstonia solanacearum infection, which offers a good system to investigate function of cytokinin in the whole pathogen infection process.
View Article and Find Full Text PDFRalstonia solanacearum Alters Root Developmental Programmes in Auxin-Dependent and -Independent Manners.
Mol Plant Pathol
December 2024
Shanghai Center for Plant Stress Biology, Center for Excellence in Molecular Plant Sciences, Chinese Academy of Sciences, Shanghai, China.
Microbial pathogens and other parasites can modify the development of their hosts, either as a target or a side effect of their virulence activities. The plant-pathogenic bacterium Ralstonia solanacearum, causal agent of the devastating bacterial wilt disease, is a soilborne microbe that invades host plants through their roots and later proliferates in xylem vessels. In this work, we studied the early stages of R.
View Article and Find Full Text PDFWant AI Summaries of new PubMed Abstracts delivered to your In-box?
Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!