Tomato leaf mold caused by () is a serious fungal disease which results in huge yield losses in tomato cultivation worldwide. In our study, we discovered that ROS (reactive oxygen species) burst was triggered by treatment in tomato leaves. RNA-sequencing was used to identify differentially expressed genes (DEGs) induced by inoculation at the early stage of invasion in susceptible tomato plants. Gene ontology (GO) terms and Kyoto Encyclopedia of Genes and Genomes (KEGG) databases were used to annotate functions of DEGs in tomato plants. Based on our comparative analysis, DEGs related to plant-pathogen interaction pathway, plant hormone signal transduction pathway and the plant phenylpropanoid pathway were further analyzed. Our results discovered that a number of core defense genes against fungal invasion were induced and plant hormone signal transduction pathways were impacted by inoculation. Further, our results showed that SA (salicylic acid) and ABA (abscisic acid) contents were accumulated while JA (jasmonic acid) content decreased after inoculation in comparison with control, and quantitative real-time PCR to detect the relative expression of genes involved in SA, ABA and JA signaling pathway further confirmed our results. Together, results will contribute to understanding the mechanisms of and tomato interaction in future.
Download full-text PDF |
Source |
---|---|
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC9763619 | PMC |
http://dx.doi.org/10.3389/fpls.2022.1085395 | DOI Listing |
Front Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFFront Insect Sci
December 2024
USDA-ARS Southern Insect Management Research Unit, Stoneville, MS, United States.
Soybean looper (SBL), (Walker 1858) (Lepidoptera: Noctuidae), is one of the most damaging insect pests of soybean, (L.) Merr., in the mid-south region of the United States, and causes significant economic losses to cotton, sunflower, tomato, and tobacco crops in the United States, Brazil, and Argentina.
View Article and Find Full Text PDFSci Data
December 2024
Institute of Plant Protection, Beijing Academy of Agriculture and Forestry Sciences, Beijing, 100097, China.
The South American tomato pinworm, Tuta absoluta (Meyrick) is a newly emerged invasive pests causing devastating loss on tomato production globally. Semiochemical-based management is a promising method for controlling this pest. However, there is little known about how T.
View Article and Find Full Text PDFCurr Res Microb Sci
November 2024
Facultad de Agronomía y Veterinaria. Universidad Autónoma de San Luis Potosí. Soledad de Graciano Sánchez, SLP, CP, 78321. México.
Currently, the use of bio-inputs is increasing due to the need to reduce the use of agrochemicals. However, one of the limitations is to preserve the viability of the living microorganisms, so it is important to find an alternative that allows us to obtain different metabolites to produce it. We evaluated three different interactions (contact, diffusible and volatile compounds) in (At) seedlings with the strain M10 and its filtered secondary metabolites (M10F).
View Article and Find Full Text PDFMol Plant Pathol
December 2024
Centro de Biotecnología Vegetal, Facultad de Ciencias de la Vida, Universidad Andrés Bello, Santiago, Chile.
In Arabidopsis thaliana, the transcription factors WRKY7, WRKY11 and WRKY17 act as negative defence regulators against Pseudomonas syringae pv. tomato (Pst) DC3000. However, their coordinated regulation of gene expression has yet to be fully explored.
View Article and Find Full Text PDFEnter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!