Brazil is among the biggest pesticide consumers in the world, with its population severely exposed to tons of such substances, both because of environmental contamination and occupational use. The health consequences of pesticide exposure are well-documented, but still sparse regarding Brazilian population. This study systematically reviewed the Brazilian studies published that address the relationship between exposure to pesticides and health problems in the Brazilian population. Also, information about pesticide use in Brazil is provided. The included studies showed that exposure to pesticides has a relevant impact on the health of the Brazilian population, regardless of age and gender, and on workers in rural areas or not. Most poisoning events seem to result from the continuous use of pesticides, whether occupationally or environmentally, characterizing a public health problem. The major consequences reported in literature were damage to the central nervous system, cancer, deleterious effects on rural workers' health, intoxications, malformations, and endocrine changes. These findings point out the need to understand the impact of chronic exposure to pesticides on severely exposed people and highlight the importance of creating public policies to protect them and avoid disease occurrence.

Download full-text PDF

Source
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC8777228PMC
http://dx.doi.org/10.3389/fpubh.2021.787438DOI Listing

Publication Analysis

Top Keywords

exposure pesticides
16
brazilian population
16
severely exposed
8
health
6
exposure
5
pesticides
5
brazilian
5
population
5
evidence human
4
human exposure
4

Similar Publications

CesA proteins response to arsenic stress in rice involves structural and regulatory mechanisms, highlighting the role of BES1/BZR1 transcript levels under arsenate exposure and significant downregulation of BZR1 protein expression. Plants interact with several hazardous metalloids during their life cycle through root and soil connection. One such metalloid, is arsenic and its perilous impact on rice cultivation is a well-known threat.

View Article and Find Full Text PDF

Chronic Kidney Disease of Unknown Etiology: A Global Health Threat in Rural Agricultural Communities-Prevalence, Suspected Causes, Mechanisms, and Prevention Strategies.

Pathophysiology

December 2024

Laboratory of Epidemiology and Research in Health Sciences, Faculty of Medicine and Pharmacy, Sidi Mohammed Ben Abdellah University, PO 1893, Km 2200, Route Sidi Harazem, Fez 30000, Morocco.

Chronic Kidney Disease of Unknown Etiology (CKDu) is a worldwide hidden health threat that is associated with progressive loss of kidney functions without showing any initial symptoms until reaching end-stage renal failure, eventually leading to death. It is a growing health problem in Asia, Central America, Africa, and the Middle East, with identified hotspots. CKDu disease mainly affects young men in rural farming communities, while its etiology is not related to hypertension, kidney stones, diabetes, or other known causes.

View Article and Find Full Text PDF

Analysis of Thiodiphenol in Rat Urine as a Biomarker of Exposure to Temephos.

J Xenobiot

December 2024

Departamento de Toxicología, Centro de Investigación y de Estudios Avanzados del Instituto Politécnico Nacional (Cinvestav-IPN), Av. IPN 2508, Col. San Pedro Zacatenco, Ciudad de México 07360, Mexico.

Temephos is an organophosphorus pesticide widely used as a larvicide in public health campaigns to control vector-borne diseases. Data on the urinary elimination of temephos metabolites are limited, and there is no validated biomarker of exposure for its evaluation. This study aimed to determine the urinary excretion kinetics of temephos and its metabolites in adult male rats.

View Article and Find Full Text PDF

Although pesticides have been a constant concern for decades, in the last ten years, public discussions and scientific research have emphasized their impact on human health and the environment, drawing increased attention to the problems associated with their use. The association of environmental stressors such as pesticides with a sugar-rich diet can contribute to the growing global metabolic disease epidemic through overlapping mechanisms of insulin resistance, inflammation, and metabolic dysregulation. The main aim of this study was to evaluate the behavioral effects of the exposure of Silver crucian carp () to a commercial insecticide formulation containing fipronil, pyriproxyfen, and other additives, as well as sucrose and their mixtures.

View Article and Find Full Text PDF

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

View Article and Find Full Text PDF

Want AI Summaries of new PubMed Abstracts delivered to your In-box?

Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!