Bacterial wilt caused by (Smith), is one of the chief severe diseases of potato in warm temperate regions, tropics and subtropics of the world. The study was conducted to isolate and identify bacterial pathogens and select the most resistant cultivars and avoid the decrease in the total value of Egyptian potato exports to the European Union (EU) due to the quarantine restrictions imposed by the EU on potato tubers exported from Egypt affected by bacterial wilt. The results of traditional identification through morphological and serological studies showed that the five isolates were isolated and identified as . Furthermore, the results illustrated that RS5 isolate showed the lowest percentage of disease incidence reduction on the three tested potatoes cultivar Bellini, Spunta and Mondial recorded 9.64%, 15.41% and 34.12%, respectively. While, RS8 isolate exhibited the highest effective one the percentage of disease reduction on all tested potato cultivars. This isolate reduced disease incidence 60.60%, 63.21% and 71.66%, compering to the healthy control treatment. The result of molecular identification represent that the probe used in Taq-man (PCR) was of the type (B2) capable to detect only biovar 2 of bacterial wilt. Furthermore, primer and probe are specific for detection of the race 3 biovar 2 strain. Positive results were obtained in all assays used including IFAS, protein content and SDS-PAGE with all five isolates. So the isolate (RS5) was the most virulence one, followed by RS1, RS3, RS2 and RS8, registered that the tested isolates were race 3, biovar 2. Also, studies focused on the form of genetic distances and similarities based on pathogenic and plant growth parameters. The results illustrate that the highest genetic similarity (0.998) was found between Bellini and Spunta cultivars as the closest but the lowest value (0.946) was found between Mondial and Bellini as most distant. These results were similarity with genetic distances and SDS-PAGE profile of the three tested potato cultivars

Download full-text PDF

Source
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC8381064PMC
http://dx.doi.org/10.1016/j.sjbs.2021.05.045DOI Listing

Publication Analysis

Top Keywords

bacterial wilt
16
resistant cultivars
8
percentage disease
8
disease incidence
8
three tested
8
bellini spunta
8
tested potato
8
potato cultivars
8
race biovar
8
genetic distances
8

Similar Publications

Sunflower Wilt (SVW) caused by is a significant threat to sunflower production in China. This soilborne disease is difficult to control. It has been observed that delayed sowing reduces the severity of SVW on different varieties and across various locations.

View Article and Find Full Text PDF

A bacterial strain, designated as A6, was isolated from the rhizosphere soil of a healthy muskmelon in Wenchang, Hainan Province, China. The cells of strain A6 were Gram-negative, aerobic, short rod and motile with a single polar flagellum. Strain A6 could tolerate up to 55.

View Article and Find Full Text PDF
Article Synopsis
  • Diseases affecting the vascular system in plants can lead to significant economic losses due to rapid destruction of crops, making quick identification of pathogens crucial for effective management.
  • The study utilized culture-independent long-read metagenomic sequencing on DNA from tomato plants displaying wilt symptoms to successfully identify pathogenic strains and predict their virulence and resistance traits.
  • The research underscores the potential for metagenomic sequencing to become a standard diagnostic tool in plant disease clinics, as the entire analysis can be completed in just two days.
View Article and Find Full Text PDF

Exploring sp. M21F004 for Biocontrol of Bacterial and Fungal Phytopathogens.

Mar Drugs

November 2024

Department of Agricultural Chemistry, Institute of Environmentally Friendly Agriculture, College of Agriculture and Life Sciences, Chonnam National University, Gwangju 61186, Republic of Korea.

This study explores the biocontrol potential of sp. M21F004, a lactic acid bacteria (LAB) isolated from marine environments, against several bacterial and fungal phytopathogens. Out of 50 marine bacterial isolates, sp.

View Article and Find Full Text PDF

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

View Article and Find Full Text PDF

Want AI Summaries of new PubMed Abstracts delivered to your In-box?

Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!