Banana vascular wilt or Moko is a disease caused by Ralstonia solanacearum. This study aimed to sequence, assemble, annotate, and compare the genomes of R. solanacearum Moko ecotypes of different sequevar strains from Brazil. Average nucleotide identity analyses demonstrated a high correlation (> 96%) between the genome sequences of strains CCRMRs277 (sequevar IIA-24), CCRMRs287 (IIB-4), CCRMRs304 (IIA-24), and CCRMRsB7 (IIB-25), which were grouped into phylotypes IIA and IIB. The number of coding sequences present in chromosomes and megaplasmids varied from 3,070 to 3,521 and 1,669 to 1,750, respectively. Pangenome analysis identified 3,378 clusters in the chromosomes, of which 2,604 were shared by all four analyzed genomes and 2,580 were single copies. In megaplasmids, 1,834 clusters were identified, of which 1,005 were shared by all four genomes and 992 were identified as single copies. Strains CCRMRsB7 and CCRMRs287 differed from the others by having unique clusters in both their chromosomes and megaplasmids, and CCRMRsB7 possessed the largest genome among all Moko ecotype strains sequenced to date. Therefore, the genomic information obtained in this study provides a theoretical basis for the identification, characterization, and phylogenetic analysis of R. solanacearum Moko ecotypes.
Download full-text PDF |
Source |
---|---|
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC7917543 | PMC |
http://dx.doi.org/10.1590/1678-4685-GMB-2020-0172 | DOI Listing |
Front Microbiol
December 2024
Department of Entomology, Louisiana State University Agricultural Center, Baton Rouge, LA, United States.
The Ironwood tree () holds a significant ecological role in Guam where a decline in Ironwood trees was first documented in 2002. Studies have linked the Ironwood tree decline (IWTD) to bacteria from the complex and wetwood bacteria, specifically and . Presence of termites was first found to be associated with IWTD in 2010; however, the role of termites in IWTD is still not clear.
View Article and Find Full Text PDFACS Omega
December 2024
Environment and Plant Protection Institute, Chinese Academy of Tropical Agricultural Science, Haikou 571101, China.
A series of coumarin-3-carboxylic acid derivatives containing a thioether quinoline moiety were designed and synthesized. The structures of these compounds were determined using H NMR, C NMR, and HRMS. The antibacterial activity of the compounds was evaluated against pv (), (), and ().
View Article and Find Full Text PDFJ Agric Food Chem
December 2024
Key Laboratory of Microbial Pesticides (Ministry of Agriculture and Rural Affairs), National Biopesticide Engineering Research Centre, Hubei Biopesticide Engineering Research Centre, Hubei Academy of Agricultural Sciences, Wuhan 430064, China.
This study investigates a novel antimicrobial peptide AtR905 derived from the endophytic fungus , which was successfully expressed in , purified, and characterized, and highlighted as a promising potential biocontrol agent against various plant pathogens. The results indicated AtR905 exhibited broad-spectrum antimicrobial activities against key pathogens such as and with very low minimal inhibitory concentrations (MICs). Stability tests confirmed that AtR905 retains its antimicrobial properties under varying thermal, pH, and UV conditions.
View Article and Find Full Text PDFFront Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFFront Microbiol
December 2024
Medical Plants Research Center, Basic Health Sciences Institute, Shahrekord University of Medical Sciences, Shahrekord, Iran.
This study aimed to screen native methionine gamma-lyase (L-methioninase) producing bacteria from soil samples and optimize the culture media for enhanced enzyme production using statistical design. Three bacteria, were identified as novel L-methioninase producers, which alternative source of L-methioninase for cancer treatment could be utilized alongside other therapeutic agents. The bacteria were isolated from various garden soils and cultured on a modified M9 medium and screened by Nessler reagent.
View Article and Find Full Text PDFEnter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!