AI Article Synopsis

  • The study focused on identifying a strain of endophytic Bacillus species that can control bacterial wilt in tomatoes via foliar spray application.
  • Fifty heat-tolerant endophytic bacteria were isolated from healthy tomato plants, and two strains, G1S3 and G4L1, showed significant effectiveness in suppressing the disease during initial tests.
  • Ultimately, G4L1 was selected as a promising biocontrol agent due to its ability to consistently reduce disease incidence and enhance plant defense mechanisms, marking it as the first reported case of controlling bacterial wilt using foliar application of an endophytic Bacillus species.

Article Abstract

The aim of the present study was to identify a strain of endophytic Bacillus species that control tomato bacterial wilt by foliar spray application. Fifty heat-tolerant endophytic bacteria were isolated from the surface-sterilized foliar tissues of symptomless tomato plants that had been pre-inoculated with the pathogen Ralstonia pseudosolanacearum. In the primary screening, we assessed the suppressive effects of a shoot-dipping treatment with bacterial strains against bacterial wilt on tomato seedlings grown on peat pellets. Bacillus sp. strains G1S3 and G4L1 significantly suppressed the incidence of tomato bacterial wilt. In subsequent pot experiments, the biocontrol efficacy of foliar spray application was examined under glasshouse conditions. G4L1 displayed consistent and significant disease suppression, and, thus, was selected as a biocontrol candidate. Moreover, the pathogen population in the stem of G4L1-treated plants was markedly smaller than that in control plants. A quantitative real-time PCR analysis revealed that the foliar spraying of tomato plants with G4L1 up-regulated the expression of PR-1a and LoxD in stem and GluB in roots upon the pathogen inoculation, implying that the induction of salicylic acid-, jasmonic acid-, and ethylene-dependent defenses was involved in the protective effects of this strain. In the re-isolation experiment, G4L1 efficiently colonized foliar tissues for at least 4‍ ‍weeks after spray application. Collectively, the present results indicate that G4L1 is a promising biocontrol agent for tomato bacterial wilt. Furthermore, to the best of our knowledge, this is the first study to report the biocontrol of bacterial wilt by the foliar spraying with an endophytic Bacillus species.

Download full-text PDF

Source
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC7734409PMC
http://dx.doi.org/10.1264/jsme2.ME20078DOI Listing

Publication Analysis

Top Keywords

bacterial wilt
24
tomato bacterial
16
spray application
16
wilt foliar
12
foliar spray
12
endophytic bacillus
12
strain endophytic
8
bacillus species
8
foliar tissues
8
tomato plants
8

Similar Publications

Article Synopsis
  • Diseases affecting the vascular system in plants can lead to significant economic losses due to rapid destruction of crops, making quick identification of pathogens crucial for effective management.
  • The study utilized culture-independent long-read metagenomic sequencing on DNA from tomato plants displaying wilt symptoms to successfully identify pathogenic strains and predict their virulence and resistance traits.
  • The research underscores the potential for metagenomic sequencing to become a standard diagnostic tool in plant disease clinics, as the entire analysis can be completed in just two days.
View Article and Find Full Text PDF

Exploring sp. M21F004 for Biocontrol of Bacterial and Fungal Phytopathogens.

Mar Drugs

November 2024

Department of Agricultural Chemistry, Institute of Environmentally Friendly Agriculture, College of Agriculture and Life Sciences, Chonnam National University, Gwangju 61186, Republic of Korea.

This study explores the biocontrol potential of sp. M21F004, a lactic acid bacteria (LAB) isolated from marine environments, against several bacterial and fungal phytopathogens. Out of 50 marine bacterial isolates, sp.

View Article and Find Full Text PDF

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

View Article and Find Full Text PDF

Cytokinin Plays a Multifaceted Role in Ralstonia solanacearum-Triggered Plant Disease Development.

Mol Plant Pathol

December 2024

State Key Laboratory of Crop Stress Resistance and High-Efficiency Production, College of Agronomy, Northwest A&F University, Yangling, China.

Cytokinin signalling plays both positive and negative roles in plant resistance to pathogens. It is not clear whether the role of cytokinin changes at the different stages of pathogen infection. Arabidopsis thaliana sequentially exhibits distinct root morphological symptoms during Ralstonia solanacearum infection, which offers a good system to investigate function of cytokinin in the whole pathogen infection process.

View Article and Find Full Text PDF

Microbial pathogens and other parasites can modify the development of their hosts, either as a target or a side effect of their virulence activities. The plant-pathogenic bacterium Ralstonia solanacearum, causal agent of the devastating bacterial wilt disease, is a soilborne microbe that invades host plants through their roots and later proliferates in xylem vessels. In this work, we studied the early stages of R.

View Article and Find Full Text PDF

Want AI Summaries of new PubMed Abstracts delivered to your In-box?

Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!