AI Article Synopsis
- Bacterial wilt is a significant disease affecting tomato crops in warmer regions, and it is caused by a specific species complex.
- Researchers identified two key genetic regions (QTL) linked to resistance on chromosomes 6 and 12 in the 'Hawaii 7996' tomato variety, but effective breeding techniques using these markers are still lacking.
- New genetic markers were developed to evaluate resistance in 117 tomato cultivars, and two markers (RsR6-5 and RsR12-1) were found to effectively identify resistant plants, paving the way for better breeding strategies against bacterial wilt.
Article Abstract
Bacterial wilt, caused by the species complex, is an important vascular disease that limits tomato production in tropical and subtropical regions. Two major quantitative trait loci (QTL) of bacterial wilt resistance on chromosome 6 () and 12 () were previously identified in 'Hawaii 7996'; however, marker-assisted breeding for bacterial wilt resistance is not well established. To dissect the QTL, six cleaved amplified polymorphic sites (CAPS) and derived CAPS (dCAPS) markers within the region and one dCAPS marker near were developed, and resistance levels in 117 tomato cultivars were evaluated. Two markers, RsR6-5 on chromosome 6 and RsR12-1 on chromosome 12, were selected based on the genotypic and phenotypic analysis. The combination of RsR6-5 and RsR12-1 effectively distinguishes resistant and susceptible cultivars. Furthermore, the efficiency of the two markers was validated in the F generation derived from the F population between E6203 (susceptible) and Hawaii 7998 (resistant). Resistant alleles at both loci led to the resistance to bacterial wilt. These markers will facilitate marker-assisted breeding of tomato resistant to bacterial wilt.
Download full-text PDF |
Source |
|---|---|
| http://www.ncbi.nlm.nih.gov/pmc/articles/PMC7495205 | PMC |
| http://dx.doi.org/10.1270/jsbbs.20027 | DOI Listing |
Publication Analysis
Top Keywords
Similar Publications
Metagenomic Sequencing of Tomato Plants with Wilt Symptoms Allows for Strain-Level Pathogen Identification and Genome-Based Characterization.
Phytopathology
January 2025
Virginia Polytechnic Institute and State University, School of Plant and Environmental Science, Blacksburg, Virginia, United States;
Article Synopsis
- Diseases affecting the vascular system in plants can lead to significant economic losses due to rapid destruction of crops, making quick identification of pathogens crucial for effective management.
- The study utilized culture-independent long-read metagenomic sequencing on DNA from tomato plants displaying wilt symptoms to successfully identify pathogenic strains and predict their virulence and resistance traits.
- The research underscores the potential for metagenomic sequencing to become a standard diagnostic tool in plant disease clinics, as the entire analysis can be completed in just two days.
Exploring sp. M21F004 for Biocontrol of Bacterial and Fungal Phytopathogens.
Mar Drugs
November 2024
Department of Agricultural Chemistry, Institute of Environmentally Friendly Agriculture, College of Agriculture and Life Sciences, Chonnam National University, Gwangju 61186, Republic of Korea.
This study explores the biocontrol potential of sp. M21F004, a lactic acid bacteria (LAB) isolated from marine environments, against several bacterial and fungal phytopathogens. Out of 50 marine bacterial isolates, sp.
View Article and Find Full Text PDFManaging tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide.
Front Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFCytokinin Plays a Multifaceted Role in Ralstonia solanacearum-Triggered Plant Disease Development.
Mol Plant Pathol
December 2024
State Key Laboratory of Crop Stress Resistance and High-Efficiency Production, College of Agronomy, Northwest A&F University, Yangling, China.
Cytokinin signalling plays both positive and negative roles in plant resistance to pathogens. It is not clear whether the role of cytokinin changes at the different stages of pathogen infection. Arabidopsis thaliana sequentially exhibits distinct root morphological symptoms during Ralstonia solanacearum infection, which offers a good system to investigate function of cytokinin in the whole pathogen infection process.
View Article and Find Full Text PDFRalstonia solanacearum Alters Root Developmental Programmes in Auxin-Dependent and -Independent Manners.
Mol Plant Pathol
December 2024
Shanghai Center for Plant Stress Biology, Center for Excellence in Molecular Plant Sciences, Chinese Academy of Sciences, Shanghai, China.
Microbial pathogens and other parasites can modify the development of their hosts, either as a target or a side effect of their virulence activities. The plant-pathogenic bacterium Ralstonia solanacearum, causal agent of the devastating bacterial wilt disease, is a soilborne microbe that invades host plants through their roots and later proliferates in xylem vessels. In this work, we studied the early stages of R.
View Article and Find Full Text PDFWant AI Summaries of new PubMed Abstracts delivered to your In-box?
Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!