Biological Control of Tomato Bacterial Wilt, Kimchi Cabbage Soft Rot, and Red Pepper Bacterial Leaf Spot Using JCK-5075.

Front Plant Sci

Department of Agricultural Chemistry, Institute of Environmentally Friendly Agriculture, College of Agriculture and Life Sciences, Chonnam National University, Gwangju, South Korea.

Published: July 2020

The over and repeated use of chemical bactericides to control plant bacterial diseases has resulted in unwanted effects, such as environmental pollution, residual toxicity, and resistance buildup in bacterial pathogens. Many previous studies have aimed to develop biological control agents to replace chemical bactericides. In this study, the antibacterial efficacy of the fermentation broth of JCK-5075 and its antibacterial compounds were evaluated against plant pathogenic bacteria, using both and bioassays. Pelgipeptins (PGPs) A, B, C, and D that were isolated from JCK-5075 displayed broad-spectrum antibacterial activity against various plant pathogenic bacteria. The fermentation broth of JCK-5075, at 5-fold dilution, effectively suppressed the development of tomato bacterial wilt, Kimchi cabbage soft rot, and red pepper bacterial leaf spot in pot experiments with control values of 81, 84, and 67%, respectively. PGP-A and C, at 200 μg/ml, were also found to markedly reduce the development of Kimchi cabbage bacterial soft rot by 75% and tomato bacterial wilt by 83%, respectively, and their disease control efficacy was comparable to that of oxolinic acid with control values of 81 and 85%, respectively. Additionally, the antibacterial activity of PGP-C was found to be directly correlated with membrane damage mechanisms. These results indicates that JCK-5075 producing PGPs could be used as a biocontrol agent for the control of plant bacterial diseases. This is the first report on the and antibacterial activity of PGPs against bacterial plant pathogens.

Download full-text PDF

Source
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC7340725PMC
http://dx.doi.org/10.3389/fpls.2020.00775DOI Listing

Publication Analysis

Top Keywords

tomato bacterial
12
bacterial wilt
12
kimchi cabbage
12
soft rot
12
antibacterial activity
12
bacterial
10
biological control
8
wilt kimchi
8
cabbage soft
8
rot red
8

Similar Publications

Discovery, Characterization, and Application of Broad-Spectrum Antimicrobial Peptide AtR905 from as a Biocontrol Agent.

J Agric Food Chem

December 2024

Key Laboratory of Microbial Pesticides (Ministry of Agriculture and Rural Affairs), National Biopesticide Engineering Research Centre, Hubei Biopesticide Engineering Research Centre, Hubei Academy of Agricultural Sciences, Wuhan 430064, China.

This study investigates a novel antimicrobial peptide AtR905 derived from the endophytic fungus , which was successfully expressed in , purified, and characterized, and highlighted as a promising potential biocontrol agent against various plant pathogens. The results indicated AtR905 exhibited broad-spectrum antimicrobial activities against key pathogens such as and with very low minimal inhibitory concentrations (MICs). Stability tests confirmed that AtR905 retains its antimicrobial properties under varying thermal, pH, and UV conditions.

View Article and Find Full Text PDF

Molecular genetic tools such as CRISPR-Cas gene editing systems are invaluable for understanding gene and protein function and revealing the details of a pathogen's life and disease cycles. Here we present protocols for genome editing in Phytophthora infestans, an oomycete with global importance as a pathogen of potato and tomato. Using a vector system that expresses variants of Cas12a from Lachnospiraceae bacterium and its guide RNA from a unified transcript, we first present a method for editing genes through the non-homologous end-joining (NHEJ) pathway.

View Article and Find Full Text PDF

Exploring sp. M21F004 for Biocontrol of Bacterial and Fungal Phytopathogens.

Mar Drugs

November 2024

Department of Agricultural Chemistry, Institute of Environmentally Friendly Agriculture, College of Agriculture and Life Sciences, Chonnam National University, Gwangju 61186, Republic of Korea.

This study explores the biocontrol potential of sp. M21F004, a lactic acid bacteria (LAB) isolated from marine environments, against several bacterial and fungal phytopathogens. Out of 50 marine bacterial isolates, sp.

View Article and Find Full Text PDF

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

View Article and Find Full Text PDF

A Ralstonia solanacearum type III effector alters the actin and microtubule cytoskeleton to promote bacterial virulence in plants.

PLoS Pathog

December 2024

Department of Botany and Plant Pathology, and Center for Plant Biology, Purdue University, West Lafayette, Indiana, United States of America.

Cellular responses to biotic stress frequently involve signaling pathways that are conserved across eukaryotes. These pathways include the cytoskeleton, a proteinaceous network that senses external cues at the cell surface and signals to interior cellular components. During biotic stress, dynamic cytoskeletal rearrangements serve as a platform from which early immune-associated processes are organized and activated.

View Article and Find Full Text PDF

Want AI Summaries of new PubMed Abstracts delivered to your In-box?

Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!