CK11 is a rainbow trout () CC chemokine phylogenetically related to both mammalian CCL27 and CCL28 chemokines, strongly transcribed in skin and gills in homeostasis, for which an immune role had not been reported to date. In the current study, we have demonstrated that CK11 is not chemotactic for unstimulated leukocyte populations from central immune organs or mucosal tissues but instead exerts a potent antimicrobial activity against a wide range of rainbow trout pathogens. Our results show that CK11 strongly inhibits the growth of different rainbow trout Gram-positive and Gram-negative bacteria, namely , subsp. , and and a parasitic ciliate Similarly to mammalian chemokines and antimicrobial peptides, CK11 exerted its antimicrobial activity, rapidly inducing membrane permeability in the target pathogens. Further transcriptional studies confirmed the regulation of CK11 transcription in response to exposure to some of these pathogens in specific conditions. Altogether, our studies related to phylogenetic relations, tissue distribution, and biological activity point to CK11 as a potential common ancestor of mammalian CCL27 and CCL28. To our knowledge, this study constitutes the first report of a fish chemokine with antimicrobial activity, thus establishing a novel role for teleost chemokines in antimicrobial immunity that supports an evolutionary relationship between chemokines and antimicrobial peptides.
Download full-text PDF |
Source |
---|---|
http://dx.doi.org/10.4049/jimmunol.1800568 | DOI Listing |
Ying Yong Sheng Tai Xue Bao
October 2024
College of Energy and Environmental Engineering, Hebei University of Engineering/Hebei Key Laboratory of Air Pollution Cause and Impact/Hebei Engineering Research Center of Sewage Treatment and Resource Utilization, Handan 056038, Hebei, China.
Estuaries are transitional zones between rivers and marine environments, with intensive human activities. Pollutants pose a threat to the ecological systems of estuaries. Among these pollutants, microplastics and antibiotic resistant genes have gained significant attention due to their potential impacts on estuarine organisms and human health.
View Article and Find Full Text PDFBiofouling
December 2024
Department of Integrative Biology, School of Biosciences and Technology, Vellore Institute of Technology, Katpadi, Vellore, India.
is a pathogenic bacterium that can infect humans and animals, yet the role of its outer membrane vesicles (OMVs) in mediating pathogenicity remains underexplored. This study evaluated the effects of linoleic acid (LA) and stearic acid (SA) on quorum sensing (QS)-mediated violacein production, biofilm formation, and OMV biogenesis in . Our findings revealed that 2 mM LA and 1 mM SA effectively quench QS, leading to a significant reduction in violacein production, biofilm formation, and OMV biogenesis.
View Article and Find Full Text PDFInt J Nanomedicine
December 2024
Department of Zoology, College of Science, King Saud University, Riyadh, 11451, Kingdom of Saudi Arabia.
Introduction: Malaria caused by spp. is the most hazardous disease in the world. It is regarded as a life-threatening hematological disorder caused by parasites transferred to humans by the bite of Anopheles mosquitoes.
View Article and Find Full Text PDFFront Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFFront Microbiol
December 2024
College of Food Science and Engineering, Qingdao Agricultural University, Qingdao, China.
Sour meat is a popular traditional fermented product and is a rich source of novel strains with probiotic potential. In this study, we aimed to assess the probiotic potential of lactic acid bacteria (LAB) strains isolated from fermented sour meat. Firstly, the microbial diversity of sour meat from four different areas in China was analyzed.
View Article and Find Full Text PDFEnter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!