Molecular and biological characterization of ϕRs551, a filamentous bacteriophage isolated from a race 3 biovar 2 strain of Ralstonia solanacearum.

PLoS One

Floral and Nursery Plants Research Unit, United States National Arboretum, U.S. Dept. of Agriculture-Agricultural Research Service, Beltsville, Maryland, United States of America.

Published: October 2017

A filamentous bacteriophage, designated ϕRs551, was isolated and purified from the quarantine and select agent phytopathogen Ralstonia solanacearum race 3 biovar 2 strain UW551 (phylotype IIB sequevar 1) grown under normal culture conditions. Electron microscopy suggested that ϕRs551 is a member of the family Inoviridae, and is about 1200 nm long and 7 nm wide. ϕRs551 has a genome of 7929 nucleotides containing 14 open reading frames, and is the first isolated virion that contains a resolvase (ORF13) and putative type-2 phage repressor (ORF14). Unlike other R. solanacearum phages isolated from soil, the genome sequence of ϕRs551 is not only 100% identical to its prophage sequence in the deposited genome of R. solanacearum strain UW551 from which the phage was isolated, but is also surprisingly found with 100% identity in the deposited genomes of 10 other phylotype II sequevar 1 strains of R. solanacearum. Furthermore, it is homologous to genome RS-09-161, resulting in the identification of a new prophage, designated RSM10, in a R. solanacearum strain from India. When ORF13 and a core attP site of ϕRs551 were either deleted individually or in combination, phage integration was not observed, suggesting that similar to other filamentous R. solanacearum ϕRSM phages, ϕRs551 relies on its resolvase and the core att sequence for site-directed integration into its susceptible R. solanacearum strain. The integration occurred four hours after phage infection. Infection of a susceptible R. solanacearum strain RUN302 by ϕRs551 resulted in less fluidal colonies and EPS production, and reduced motilities of the bacterium. Interestingly, infection of RUN302 by ϕRs551 also resulted in reduced virulence, rather than enhanced or loss of virulence caused by other ϕRSM phages. Study of bacteriophages of R. solanacearum would contribute to a better understanding of the phage-bacterium-environment interactions in order to develop integrated management strategies to combat R. solanacearum.

Download full-text PDF

Source
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC5608472PMC
http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0185034PLOS

Publication Analysis

Top Keywords

solanacearum strain
16
solanacearum
11
ϕrs551
9
filamentous bacteriophage
8
race biovar
8
biovar strain
8
ralstonia solanacearum
8
strain uw551
8
ϕrsm phages
8
susceptible solanacearum
8

Similar Publications

Synthetic peptides bioactive against phytopathogens have lower impact on some beneficial bacteria: An assessment of peptides biosafety in agriculture.

J Environ Manage

January 2025

iB(2) Laboratory, Department of Biology, Faculty of Sciences, University of Porto, Portugal; Instituto de Conservación y Mejora de la Agrodiversidad Valenciana, Universitat Politècnica de València, Spain; LAQV-REQUIMTE, Department of Biology, Faculty of Sciences, University of Porto, Portugal. Electronic address:

The emergence of bacterial resistance and the increasing restrictions on the use of agrochemicals are boosting the search for novel, sustainable antibiotics. Antimicrobial peptides (AMPs) arise as a new generation of antibiotics due to their effectiveness at low doses and biocompatibility. We compared the antimicrobial activity of four promising AMPs (CA-M, BP100, RW-BP100, and 3.

View Article and Find Full Text PDF

Three novel quinoline alkaloids from Tetradium glabrifolium and their antibacterial activities.

Chem Biodivers

January 2025

Guizhou Medical University, State Key Laboratory of Functions and Applications of Medicinal Plants, , 550014, 436831, Guiyang, CHINA.

Three novel quinoline alkaloids, tetradiunitiside A (1), tetradiunitiside B (2), glycohaplopine-6-O-α-L-rhamnopyranoside (3), along with eight known ones (4-11) were isolated from the fruits of Tetradium glabrifolium. Their structures were inferred by IR, 1D NMR and 2D NMR and HR-ESI-MS spectra. All the isolated compounds were evaluated for the antibacterial activities.

View Article and Find Full Text PDF
Article Synopsis
  • Diseases affecting the vascular system in plants can lead to significant economic losses due to rapid destruction of crops, making quick identification of pathogens crucial for effective management.
  • The study utilized culture-independent long-read metagenomic sequencing on DNA from tomato plants displaying wilt symptoms to successfully identify pathogenic strains and predict their virulence and resistance traits.
  • The research underscores the potential for metagenomic sequencing to become a standard diagnostic tool in plant disease clinics, as the entire analysis can be completed in just two days.
View Article and Find Full Text PDF

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

View Article and Find Full Text PDF

A novel type III effector RipBU from Ralstonia solanacearum suppresses plant immunity and promotes peanut susceptibility.

Int J Biol Macromol

January 2025

Guangzhou key laboratory for research and development of crop germplasm resources, Zhongkai University of Agriculture and Engineering, Guangzhou 510225, Guangdong, China. Electronic address:

A predicted peanut R. solanacearum T3E RS_T3E_Hyp6 was identified as a definite T3E and renamed as RipBU. It is relative conserved in 31 R.

View Article and Find Full Text PDF

Want AI Summaries of new PubMed Abstracts delivered to your In-box?

Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!