AI Article Synopsis
Article Abstract
Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na and K channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.
Download full-text PDF |
Source |
|---|---|
| http://dx.doi.org/10.1007/s00726-017-2425-2 | DOI Listing |
Publication Analysis
Top Keywords
Similar Publications
Interactive effects between yields of Bt and non-Bt corn and planting dates in the southeastern United States.
J Econ Entomol
January 2025
Department of Entomology and Plant Pathology, North Carolina State University, the Vernon G. James Research and Extension Center, Plymouth, NC, USA.
Transgenic corn (Zea mays L.) expressing insecticidal toxins from Bacillus thuringiensis (Bt) helps to control or suppress injury from a range of target insect pests. This study summarizes the yield benefits of Bt corn from field trials in Georgia, North Carolina, and South Carolina evaluating Bt and non-Bt corn hybrids from 2009 to 2023.
View Article and Find Full Text PDFDiscovery of a Novel Insecticidal Peptide with a Cystine-Stabilized α-Helix/α-Helix Motif from the Venom of Scorpion .
Molecules
December 2024
Graduate School of Agriculture, Kyoto University, Kyoto 606-8502, Japan.
Scorpion venom contains various bioactive peptides, many of which exhibit insecticidal activity. The majority of these peptides have a cystine-stabilized α-helix/β-sheet (CSαβ) motif. In addition to these peptides, scorpion venom also contains those with a cystine-stabilized α-helix/α-helix (CSαα) motif, which are known as κ-KTx peptides.
View Article and Find Full Text PDFEstablishing best practices for insect resistance management: a new paradigm for genetically engineered toxins in cotton expressing Mpp51Aa2.
J Econ Entomol
January 2025
Department of Entomology and Plant Pathology and the North Carolina Plant Sciences Institute, NC State University, Raleigh, NC, USA.
Debate over resistance management tactics for genetically engineered (GE) crops expressing insecticidal toxins is not new. For several decades, researchers, regulators, and agricultural industry scientists have developed strategies to limit the evolution of resistance in populations of lepidopteran and coleopteran pests. A key attribute of many of these events was insecticide resistance management (IRM) strategies designed around a presumed high-dose expression sufficient to kill 99.
View Article and Find Full Text PDFRecombinant venom proteins in insect seminal fluid reduce female lifespan.
Nat Commun
January 2025
Applied BioSciences, Macquarie University, Sydney, NSW 2109, Australia.
The emergence of insecticide resistance has increased the need for alternative pest management tools. Numerous genetic biocontrol approaches, which involve the release of genetically modified organisms to control pest populations, are in various stages of development to provide highly targeted pest control. However, all current mating-based genetic biocontrol technologies function by releasing engineered males which skew sex-ratios or reduce offspring viability in subsequent generations which leaves mated females to continue to cause harm (e.
View Article and Find Full Text PDFGenomic Insights into the Bactericidal and Fungicidal Potential of b12.3 Isolated in the Soil of Olkhon Island in Lake Baikal, Russia.
Microorganisms
November 2024
All-Russia Research Institute for Agricultural Microbiology, 196608 St. Petersburg, Russia.
Article Synopsis
- This study highlights the importance of finding natural biocontrol agents to combat plant pathogens that threaten the global food supply.
- The strain b12.3, isolated from Olkhon Island, possesses the ability to inhibit various plant pathogens and shows potential as a biocontrol agent.
- Advanced genomic analysis revealed that b12.3 has multiple biosynthetic gene clusters and insecticidal genes, suggesting its effectiveness in pest management and providing insight into its ecological role in Lake Baikal.
Want AI Summaries of new PubMed Abstracts delivered to your In-box?
Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!