The labile nature of phosphoryl groups has presented a long-standing challenge for the characterization of protein phosphorylation via conventional mass spectrometry-based bottom-up proteomics methods. Collision-induced dissociation (CID) causes preferential cleavage of the phospho-ester bond of peptides, particularly under conditions of low proton mobility, and results in the suppression of sequence-informative fragmentation that often prohibits phosphosite determination. In the present study, the fragmentation patterns of phosphopeptides are improved through ion/ion-mediated peptide derivatization with 4-formyl-1,3-benezenedisulfonic acid (FBDSA) anions using a dual spray reactor. This approach exploits the strong electrostatic interactions between the sulfonate moieties of FBDSA and basic sites to facilitate gas-phase bioconjugation and to reduce charge sequestration and increase the yield of phosphate-retaining sequence ions upon CID. Moreover, comparative CID fragmentation analysis between unmodified phosphopeptides and those modified online with FBDSA or in solution via carbamylation and 4-sulfophenyl isothiocyanate (SPITC) provided evidence for sulfonate interference with charge-directed mechanisms that result in preferential phosphate elimination. Our results indicate the prominence of charge-directed neighboring group participation reactions involved in phosphate neutral loss, and the implementation of ion/ion reactions in a dual spray reactor setup provides a means to disrupt the interactions by competing hydrogen-bonding interactions between sulfonate groups and the side chains of basic residues.
Download full-text PDF |
Source |
---|---|
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC5477467 | PMC |
http://dx.doi.org/10.1021/acs.analchem.6b01901 | DOI Listing |
Front Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFACS Bio Med Chem Au
December 2024
The University of Arizona College of Pharmacy, Skaggs Pharmaceutical Sciences Center, Tucson, Arizona 85721, United States.
This study introduces novel cospray-dried (Co-SD) formulations of simvastatin, a Nrf2 activator ROCK inhibitor, with l-carnitine as molecular mixtures in various molar ratios for targeted pulmonary inhalation aerosol delivery in pulmonary hypertension, optimized for excipient-free dry powder inhalers (DPIs). The two components were spray-dried at various molar ratios by using different starting feed solution concentrations and process parameters. In addition to comprehensive physicochemical characterization, in vitro aerosol dispersion performance as DPIs using two FDA-approved DPI devices with different shear stress properties, in vitro viability as a function of dose on 2D human pulmonary cellular monolayers and on 3D small airway epithelia human primary cultures at the air-liquid interface (ALI), and in vitro transepithelial electrical resistance (TEER) at the ALI were conducted.
View Article and Find Full Text PDFInt J Biol Macromol
December 2024
Department of Drugs and Medicines, School of Pharmaceutical Sciences, São Paulo State University (UNESP), Araraquara 14800-903, SP, Brazil. Electronic address:
Ulcerative colitis (UC) is a chronic inflammatory bowel disease initially treated with mesalazine (5-ASA). However, its effectiveness is limited by rapid absorption, low colonic concentration, and exacerbation of dysbiosis. Probiotics can mitigate dysbiosis if they survive the acidic conditions of the stomach.
View Article and Find Full Text PDFTransl Anim Sci
December 2024
Institute of Animal Science, Beef Cattle Research Center, Sertãozinho, Brazil.
The objective of this study was to evaluate the efficacy of using 3 yeast-based additives as an alternative to sodium monensin on rumen fermentation parameters using a dual-flow continuous fermentation system. Ten fermenters (1,223 ± 21 mL) were used in 2 simultaneous 5 × 5 Latin squares arrangement with 3 periods of 10 d each, with 7 d for diet adaptation and 3 d for sample collections. Each Latin square assigning either a low or high level of concentrate to beef cattle diets, with 5 specified treatments: Control: no additives; Blend 1: yeast culture (), beta-glucans, fructooligosaccharides, galactooligosaccharides, and mannanoligosaccharides [1,600 mg/kg dry matter (DM)]; Blend 2: Beta-glucan and mannanoligosaccharide fractions from (1,600 mg/kg DM); Yeast Cells: hydrolyzed, inactivated, and spray-dried yeast cells (; 2,133 mg/kg DM); monensin (25 mg/kg DM).
View Article and Find Full Text PDFInt J Biol Macromol
December 2024
Laboratory of Polymeric Materials and Biosorbents, Universidade Federal de São Carlos, UFSCar, 13600970 Araras, SP, Brazil. Electronic address:
Enhanced efficiency fertilizers (EEFs) are critical for sustainable agriculture, providing essential nutrients while minimizing environmental impact. However, developing EEFs that effectively degrade after use remains a significant challenge. This study investigates the biodegradation and nutrient release profiles of EEFs composed of poly(vinyl alcohol) (PVA) and starch-nutrient microspheres.
View Article and Find Full Text PDFEnter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!