Pines in the subalpine environment at Niwot Ridge, CO, have been found to host communities of acetic acid bacteria (AAB) within their needles. The significance and ubiquity of this pattern is not known, but recent evidence of nitrogen (N)-fixing activity in Pinus flexilis (limber pine) foliage calls for a better understanding of the processes that regulate endophytic communities in forest tree canopies. Here, to test if AAB dominate the foliar bacterial microbiota in other subalpine locations, we compared the 16S rRNA community in needles from P. flexilis and P. contorta (lodgepole pine) growing in the Eastern Sierra Nevada, CA, and Niwot Ridge, CO. AAB made up the majority of the bacterial community in both species at both sites. Multiple distinct AAB taxa, resolved at the single nucleotide level, were shared across host species and sites, with dominant OTUs identical or highly similar to database sequences from cold environments, including high altitude air sampled in Colorado, and the endosphere of Arctic plants. Our results suggest strong selection for community composition, potentially amplified by the long lifespan of individual Pinus needles, along with low dispersal constraints on canopy bacteria.
Download full-text PDF |
Source |
---|---|
http://dx.doi.org/10.1093/femsec/fiw124 | DOI Listing |
Mol Plant Microbe Interact
January 2025
Univ of Georgia, Plant Pathology, 3303 Miller Plant Sciences, Athens, United States, 30602;
Slippery skin of onion caused by pv. (Bga) is a common bacterial disease reported from onion growing regions around the world. Despite the increasing attention in recent years, our understanding of the virulence mechanisms of this pathogen remains limited.
View Article and Find Full Text PDFEnviron Microbiome
January 2025
Department of Plant Breeding, Swedish University of Agricultural Sciences, Alnarp, Sweden.
Background: Fusarium head blight (FHB) is a major disease affecting cereal crops including wheat, barley, rye, oats and maize. Its predominant causal agent is the ascomycete fungus Fusarium graminearum, which infects the spikes and thereby reduces grain yield and quality. The frequency and severity of FHB epidemics has increased in recent years, threatening global food security.
View Article and Find Full Text PDFBiology (Basel)
December 2024
Department of Microbiology, Faculty of Agriculture, Cairo University, Giza 12613, Egypt.
The widespread use of pesticides to manage has led to significant challenges. This insect has developed resistance to 47 active insecticide ingredients. Therefore, endophytic entomopathogenic bacteria have been explored as an alternative pest management strategy, offering the potential to reduce reliance on chemical pesticides.
View Article and Find Full Text PDFJ Environ Manage
January 2025
State Key Laboratory of Vegetable Biobreeding, Key Laboratory of Biology and Genetic Improvement of Tuber and Root Crop of Ministry of Agriculture and Rural Affairs of the Ministry of Agriculture and Rural Affairs, Institute of Vegetables and Flowers, Chinese Academy of Agricultural Sciences, No.12, Zhongguancun South Street, Haidian District, Beijing, 100081, PR China.
Beneficial interactions between plant root exudates and the rhizosphere microbial community can alleviate the adverse effects of environmental stress on crop yields, but these interactions remain poorly understood in potato growing in drying soil. We investigated the responses of rhizosphere soil microorganisms and metabolites, and biochemical and physiological responses of two potato genotypes with contrasting drought tolerance (drought tolerant 'C93' and drought sensitive 'Favorita'), to two different irrigation treatments imposing contrasting soil water availability in the field. Deficit irrigation altered rhizosphere soil bacterial communities and metabolites of C93 more than Favorita.
View Article and Find Full Text PDFFront Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFEnter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!