Iteron-containing plasmids are model systems for studying the metabolism of extrachromosomal genetic elements in bacterial cells. Here we describe the current knowledge and understanding of the structure of iteron-containing replicons, the structure of the iteron plasmid encoded replication initiation proteins, and the molecular mechanisms for iteron plasmid DNA replication initiation. We also discuss the current understanding of control mechanisms affecting the plasmid copy number and how host chaperone proteins and proteases can affect plasmid maintenance in bacterial cells.
Download full-text PDF |
Source |
|---|---|
| http://dx.doi.org/10.1128/microbiolspec.PLAS-0026-2014 | DOI Listing |
Publication Analysis
Top Keywords
Similar Publications
2-Carboxyquinoline Boronic Acids as Highly Potent KPC Inhibitors.
ChemMedChem
December 2024
East China University of Science and Technology School of Pharmacy, Department of Pharmaceutical Sciences, 130 Meilong Rd., 200237, Shanghai, CHINA.
The expression of Klebsiella pneumoniae carbapenemase (KPC), a type of carbapenem-hydrolyzing β-lactamase, in Gram-negative bacteria has caused significant bacterial resistance to carbapenems, the antibiotic of last resort. Herein, we describe the discovery of 2-carboxyquinoline boronic acids as inhibitor of KPC. We have identified fluoro-substituted carboxyquinoline boronic acids 1e as the most potent inhibitor, with an IC50 of 8.
View Article and Find Full Text PDFAn intracellular bacterial pathogen triggers RIG-I/MDA5-dependent necroptosis.
Curr Res Microb Sci
November 2024
CAS and Shandong Province Key Laboratory of Experimental Marine Biology, Institute of Oceanology; CAS Center for Ocean Mega-Science, Chinese Academy of Sciences, Qingdao, China.
RIG-I and MDA5 are members of RIG-I-like receptors (RLRs) that detect viral RNA within the cytoplasm and subsequently initiate antiviral immune responses. Necroptosis is a form of programmed cell death (PCD) executed by mixed lineage kinase domain-like (MLKL), which, upon phosphorylation by receptor-interacting protein kinase 3 (RIPK3), causes necrotic cell death. To date, no link between RLRs and necroptosis has been observed during bacterial infection.
View Article and Find Full Text PDFManaging tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide.
Front Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFAloe-emodin plus TIENAM ameliorate cecal ligation and puncture-induced sepsis in mice by attenuating inflammation and modulating microbiota.
Front Microbiol
December 2024
First Hospital of Quanzhou Affiliated to Fujian Medical University, Quanzhou, Fujian, China.
Despite the high sepsis-associated mortality, effective and specific treatments remain limited. Using conventional antibiotics as TIENAM (imipenem and cilastatin sodium for injection, TIE) is challenging due to increasing bacterial resistance, diminishing their efficacy and leading to adverse effects. We previously found that aloe-emodin (AE) exerts therapeutic effects on sepsis by reducing systemic inflammation and regulating the gut microbiota.
View Article and Find Full Text PDFouter membrane vesicles and infected cell exosomes: new players in host immune modulation and pathogenesis.
Front Immunol
December 2024
Department of Clinical Laboratory, The First People's Hospital of Kunshan, Kunshan, Jiangsu, China.
Outer membrane vesicles (OMVs) and exosomes are essential mediators of host-pathogen interactions. Elucidating their mechanisms of action offers valuable insights into diagnosing and treating infectious diseases and cancers. However, the specific interactions of () with host cells via OMVs and exosomes in modulating host immune responses have not been thoroughly investigated.
View Article and Find Full Text PDFWant AI Summaries of new PubMed Abstracts delivered to your In-box?
Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!