Ralstonia solanacearum Indian strains Rs-09-161 and Rs-10-244 were isolated from the coastal region of Goa and from the Andaman Islands. We report the draft genome sequences of these representative isolates infecting solanaceous vegetables in India.
Download full-text PDF |
Source |
|---|---|
| http://www.ncbi.nlm.nih.gov/pmc/articles/PMC4038872 | PMC |
| http://dx.doi.org/10.1128/genomeA.00323-14 | DOI Listing |
Publication Analysis
Top Keywords
Similar Publications
Discovery, Characterization, and Application of Broad-Spectrum Antimicrobial Peptide AtR905 from as a Biocontrol Agent.
J Agric Food Chem
December 2024
Key Laboratory of Microbial Pesticides (Ministry of Agriculture and Rural Affairs), National Biopesticide Engineering Research Centre, Hubei Biopesticide Engineering Research Centre, Hubei Academy of Agricultural Sciences, Wuhan 430064, China.
This study investigates a novel antimicrobial peptide AtR905 derived from the endophytic fungus , which was successfully expressed in , purified, and characterized, and highlighted as a promising potential biocontrol agent against various plant pathogens. The results indicated AtR905 exhibited broad-spectrum antimicrobial activities against key pathogens such as and with very low minimal inhibitory concentrations (MICs). Stability tests confirmed that AtR905 retains its antimicrobial properties under varying thermal, pH, and UV conditions.
View Article and Find Full Text PDFManaging tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide.
Front Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFThe native Iranian soil bacteria with high potential to produce extracellular methionine gamma-lyase.
Front Microbiol
December 2024
Medical Plants Research Center, Basic Health Sciences Institute, Shahrekord University of Medical Sciences, Shahrekord, Iran.
This study aimed to screen native methionine gamma-lyase (L-methioninase) producing bacteria from soil samples and optimize the culture media for enhanced enzyme production using statistical design. Three bacteria, were identified as novel L-methioninase producers, which alternative source of L-methioninase for cancer treatment could be utilized alongside other therapeutic agents. The bacteria were isolated from various garden soils and cultured on a modified M9 medium and screened by Nessler reagent.
View Article and Find Full Text PDFCytokinin Plays a Multifaceted Role in Ralstonia solanacearum-Triggered Plant Disease Development.
Mol Plant Pathol
December 2024
State Key Laboratory of Crop Stress Resistance and High-Efficiency Production, College of Agronomy, Northwest A&F University, Yangling, China.
Cytokinin signalling plays both positive and negative roles in plant resistance to pathogens. It is not clear whether the role of cytokinin changes at the different stages of pathogen infection. Arabidopsis thaliana sequentially exhibits distinct root morphological symptoms during Ralstonia solanacearum infection, which offers a good system to investigate function of cytokinin in the whole pathogen infection process.
View Article and Find Full Text PDFA Ralstonia solanacearum type III effector alters the actin and microtubule cytoskeleton to promote bacterial virulence in plants.
PLoS Pathog
December 2024
Department of Botany and Plant Pathology, and Center for Plant Biology, Purdue University, West Lafayette, Indiana, United States of America.
Cellular responses to biotic stress frequently involve signaling pathways that are conserved across eukaryotes. These pathways include the cytoskeleton, a proteinaceous network that senses external cues at the cell surface and signals to interior cellular components. During biotic stress, dynamic cytoskeletal rearrangements serve as a platform from which early immune-associated processes are organized and activated.
View Article and Find Full Text PDFWant AI Summaries of new PubMed Abstracts delivered to your In-box?
Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!