The Pacific iguanas of the Fijian and Tongan archipelagos are a biogeographic enigma in that their closest relatives are found only in the New World. They currently comprise two genera and four species of extinct and extant taxa. The two extant species, Brachylophus fasciatus from Fiji, Tonga, and Vanuatu and Brachylophus vitiensis from western Fiji, are of considerable conservation concern with B. vitiensis listed as critically endangered. A recent molecular study has shown that Brachylophus comprised three evolutionarily significant units. To test these conclusions and to reevaluate the phylogenetic and biogeographic relationships within Brachylophus, we generated an mtDNA dataset consisting of 1462 base pairs for 61 individuals from 13 islands, representing both Brachylophus species. Unweighted parsimony analyses and Bayesian analyses produced a well-resolved phylogenetic hypothesis supported by high bootstrap values and posterior probabilities within Brachylophus. Our data reject the monophyly of specimens previously believed to comprise B. fasciatus. Instead, our data demonstrate that living Brachylophus comprise three robust and well-supported clades that do not correspond to current taxonomy. One of these clades comprises B. fasciatus from the Lau group of Fiji and Tonga (type locality for B. fasciatus), while a second comprises putative B. fasciatus from the central regions of Fiji, which we refer to here as B. n. sp. Animals in this clade form the sister group to B. vitiensis rather than other B. fasciatus. We herein describe this clade as a new species of Brachylophus based on molecular and morphological data. With only one exception, every island is home to one or more unique haplotypes. We discuss alternative biogeographic hypotheses to explain their distribution in the Pacific and the difficulties of distinguishing these. Together, our molecular and taxonomic results have important implications for future conservation initiatives for the Pacific iguanas.

Download full-text PDF

Source
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2607380PMC
http://dx.doi.org/10.1098/rstb.2008.0120DOI Listing

Publication Analysis

Top Keywords

molecular morphological
8
critically endangered
8
pacific iguanas
8
brachylophus
8
species brachylophus
8
fiji tonga
8
fasciatus
6
molecular
4
morphological analysis
4
analysis critically
4

Similar Publications

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

View Article and Find Full Text PDF

Dryopteris×subdiffracta (Dryopteridaceae), a new natural hybrid fern from Guangxi, China.

PhytoKeys

December 2024

Germplasm Bank of Wild Species, Kunming Institute of Botany, Chinese Academy of Sciences, Kunming, Yunnan, 650201, China Kunming Institute of Botany, Chinese Academy of Sciences Kunming China.

A new natural hybrid fern, Dryopteris×subdiffracta (Dryopteridaceae), is reported from Guangxi, China. Molecular phylogenetic analysis based on DNA sequences from the low-copy nuclear marker and plastid genome revealed respectively that and are parents of the new hybrid, with as the maternal parent. Cytometric analysis of the nuclear DNA content indicated that might be a diploid hybrid.

View Article and Find Full Text PDF

Juxtaglomerular cell tumor (JxGCT) is a rare type of renal neoplasm demonstrating morphologic overlap with some mesenchymal tumors such as glomus tumor (GT) and solitary fibrous tumor (SFT). Its oncogenic drivers remain elusive, and only a few cases have been analyzed with modern molecular techniques. In prior studies, loss of chromosomes 9 and 11 appeared to be recurrent.

View Article and Find Full Text PDF

Impact of dyslipidemia and lipid-lowering therapy with statins in patients with neuroendocrine tumors.

J Neuroendocrinol

December 2024

Endocrinology, Diabetology and Andrology Unit, Department of Clinical Medicine and Surgery, Federico II University of Naples, Naples, Italy.

Dyslipidemia is a potential unfavorable prognostic factor in neuroendocrine tumors (NETs); conversely, statins proved to have antiproliferative effects in NET cell lines and could be a helpful therapeutic strategy for these patients. The main objective of this observational cohort retrospective study is to explore the associations between dyslipidemia and NET progression and evaluate the potential influence of statins in this context. 393 patients with histologically confirmed gastroenteropancreatic or bronchopulmonary NETs from six Italian centres didicated to NET diagnosis and therapy were included.

View Article and Find Full Text PDF

Oshmarin & Demshin, 1972 is redescribed from the posterior intestine of tropical tortoise (Gmelin, 1789) (Testudines: Geoemydidae) from China. Some characteristic features of the male reproductive system not reported previously are now reported for the present species. These include the presence of two blind diverticula near the mid-region of the seminal vesicle and a small cuticular structure near the opening of the cloaca - which we propose to name the 'scutum.

View Article and Find Full Text PDF

Want AI Summaries of new PubMed Abstracts delivered to your In-box?

Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!