Host defense peptides (historically called antimicrobial peptides, AMPs) are key components in the mammalian innate immune system, and are responsible for both direct killing and immunomodulatory effects in host defense against pathogenic organisms. In order to identify novel host defense peptides by sequence analysis, we constructed the AMPer resource (http://www.cnbi2.com/cgi-bin/amp.pl) that utilizes hidden Markov models to recognize sequences of antimicrobial peptides. In the current work, we utilized the AMPer resource to search bovine expressed sequence tags from the NCBI dbEST project and the bovine genome sequence for novel host defense peptides. Of the 34 known bovine AMPs, 27 were identified with high confidence in the AMPs predicted from ESTs. A further potential 68 AMPs predicted from the EST data were found that appear to be novel giving a total estimate of 102 AMPs present in the genome. Two of these were cathelicidins and selected for experimental verification in RNA derived from bovine tissue. One predicted AMP, most similar to rabbit '15 kDa protein' AMP, was confirmed to be present in infected bovine intestinal tissue using PCR. These findings demonstrated the practical applicability of the developed bioinformatics approach and laid a foundation for future discoveries of gene-coded AMPs. No members of the alpha-defensin family were found in the bovine sequences. Since we could find no technical reasons these would be missed and no references to bovine alpha-defensins in the literature, this suggests that cattle lack this important family of host defense peptides.
Download full-text PDF |
Source |
---|---|
http://dx.doi.org/10.1002/prot.22059 | DOI Listing |
Physiol Plant
December 2024
College of Horticulture, Gansu Agricultural University, Lanzhou, China.
Valsa canker, caused by fungal pathogens in Valsa species, is a fungal disease of apple and pear growing in China and even in Asia. Malectin-like kinases play crucial roles in plant recognition of the pathogen-induced signals and subsequent activation of partially host immune responses. However, the role of MEDOS1 (MDS1), a Malectin-like kinase, in plant immunity has not yet been extensively explored.
View Article and Find Full Text PDFWiley Interdiscip Rev RNA
December 2024
Laboratory of Biochemistry and Genetics, National Institute of Diabetes and Digestive and Kidney Diseases, National Institutes of Health, Bethesda, Maryland, USA.
Ribonuclease L is an endonuclease that is activated as part of the dsRNA-driven innate immune response. Active RNase L cleaves pathogenic RNAs as a way to eliminate infections. However, there are additional and unexpected ways that RNase L causes changes in the host that promote an immune response and contribute to its role in host defense.
View Article and Find Full Text PDFPhysiol Plant
December 2024
Department of Plant and Environmental Sciences, University of Copenhagen, Taastrup, Denmark.
The classic plant growth-promoting phytohormone cytokinin has been identified and established as a mediator of pathogen resistance in different plant species. However, the resistance effect of structurally different cytokinins appears to vary and may regulate diverse mechanisms to establish resistance. Hence, we comparatively analysed the impact of six different adenine- and phenylurea-type cytokinins on the well-established pathosystem Nicotiana tabacum-Pseudomonas syringae.
View Article and Find Full Text PDFFront Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFFront Insect Sci
December 2024
USDA-ARS Southern Insect Management Research Unit, Stoneville, MS, United States.
Soybean looper (SBL), (Walker 1858) (Lepidoptera: Noctuidae), is one of the most damaging insect pests of soybean, (L.) Merr., in the mid-south region of the United States, and causes significant economic losses to cotton, sunflower, tomato, and tobacco crops in the United States, Brazil, and Argentina.
View Article and Find Full Text PDFEnter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!