Download full-text PDF |
Source |
|---|
Publication Analysis
Top Keywords
Similar Publications
Predicting fine-scale downstream migratory movement of Atlantic salmon smolt (Salmo salar) in front of a hydropower plant.
Sci Rep
December 2024
Norwegian Institute for Nature Research, Postbox 5685, 7485, Trondheim, Norway.
The Atlantic salmon (Salmo salar) is an iconic species of significant ecological and economic importance. Their downstream migration as smolts represents a critical life-history stage that exposes them to numerous challenges, including passage through hydropower plants. Understanding and predicting fine-scale movement patterns of smolts near hydropower plants is therefore essential for adaptive and effective management and conservation of this species.
View Article and Find Full Text PDFRoot-associated microbial diversity and metabolomics in maize resistance to stalk rot.
Front Microbiol
December 2024
State Key Laboratory of North China Crop Improvement and Regulation, Hebei Agricultural University, Baoding, China.
As one of the three major food crops in the world, maize plays a significant role in alleviating the food crisis. Maize stalk rot can reduce maize yield and mechanical harvesting efficiency. In addition, mycotoxins such as Deoxynivalenol (DON) and Zearalenone (ZEN) produced by maize stalk rot pathogens can also harm livestock and human health.
View Article and Find Full Text PDFManaging tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide.
Front Microbiol
December 2024
Amity Institute of Microbial Technology, Amity University Uttar Pradesh, Noida, India.
The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFEcological interactions, host plant defenses, and control strategies in managing soybean looper, (Lepidoptera: Noctuidae).
Front Insect Sci
December 2024
USDA-ARS Southern Insect Management Research Unit, Stoneville, MS, United States.
Soybean looper (SBL), (Walker 1858) (Lepidoptera: Noctuidae), is one of the most damaging insect pests of soybean, (L.) Merr., in the mid-south region of the United States, and causes significant economic losses to cotton, sunflower, tomato, and tobacco crops in the United States, Brazil, and Argentina.
View Article and Find Full Text PDFEvaluation of the quality of depression-related information on Chinese websites and video platforms: a cross-sectional comparative analysis.
Front Psychiatry
December 2024
Department of Social Medicine and Health Management, Xiangya School of Public Health, Central South University, Changsha, China.
Objectives: We aimed to assess the quality of information regarding depression on Chinese websites and popular video platforms.
Methods: We conducted searches on website platforms (Baidu, Bing) and video platforms (Bilibili, Douyin) using search terms "depression", "depressive disorder", "depression treatment", "depressive anxiety", "depressed patient", and "depressive symptoms". We collected the first 50 results with each search term in each platform.
Want AI Summaries of new PubMed Abstracts delivered to your In-box?
Enter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!