An HPLC analysis of hemolymph extracts was undertaken to uncover differences between desert locusts, Schistocerca gregaria, reared under either crowded or isolated conditions. Some differences in the chromatographic pattern could be detected. One of the major peaks in the hemolymph of crowd-reared adults was found to be a minor one in isolated-reared individuals, whereas other peaks increased after solitarization. The differences became even more pronounced after several generations of isolated rearing. The dominant chromatographic peak in hemolymph extracts of the crowd-reared animals was identified as a novel peptide with a molecular mass of 6080Da. Edman degradation in combination with enzymatic fragmentation and quadrupole-time of flight (Q-Tof) mass spectrometry revealed the full sequence: DNADEDTICVAADNKFYLYANSLKLYTCYNQLPKVYVVKPKSQCRSSLSDCPTS. This 54 aa-peptide is very abundant in hemolymph of crowd-reared adults. Its concentration in hemolymph amounts to 0.1mM. To uncover the function, its effects were investigated in several bioassays, so far without positive results. One of the other peaks differentially expressed in the individuals of the two phases was identified as SGPI-2 (MW=3794Da), which is a serine protease inhibitor in locusts.
Download full-text PDF |
Source |
---|---|
http://dx.doi.org/10.1016/s0196-9781(02)00175-4 | DOI Listing |
PLoS One
January 2025
School of Mathematics and Statistics, College of Science, Rochester Institute of Technology, Rochester, New York, United States of America.
This study presents a novel non-autonomous mathematical model to explore the intricate relationship between temperature and desert locust population dynamics, considering the influence of both solitarious and gregarious phases across all life stages. The model incorporates temperature-dependent parameters for key biological processes, including egg development, hopper growth, adult maturation, and reproduction. Theoretical analysis reveals the model's capacity for complex dynamical behaviors, such as multiple stable states and backward bifurcations, suggesting the potential for sudden and unpredictable population shifts.
View Article and Find Full Text PDFBull Entomol Res
January 2025
State Key Laboratory for Biology of Plant Diseases and Insect Pests, Institute of Plant Protection, Chinese Academy of Agricultural Sciences, Beijing 100193, P.R. China.
The desert locust () is a destructive migratory pest, posing great threat to over 60 countries globally. In the backdrop of climate change, the habitat suitability of desert locusts is poised to undergo alterations. Hence, investigating the shifting dynamics of desert locust habitats holds profound significance in ensuring global agricultural resilience and food security.
View Article and Find Full Text PDFSci Rep
December 2024
India Meteorological Department, New Delhi, 110003, India.
Desert locusts, notorious for their ruinous impact on agriculture, threaten over 20% of Earth's landmass, prompting billions in losses and global food scarcity concerns. With billions of these locusts invading agrarian lands, this is no longer a thing of the past. Recent invasions, such as those in India, where losses reached US$ 3 billion in 2019-20 alone, underscore the urgency of action.
View Article and Find Full Text PDFProc Natl Acad Sci U S A
January 2025
Department of Zoology, University of Cambridge, Cambridge CB2 3EJ, United Kingdom.
Resilin, an elastomeric protein with remarkable physical properties that outperforms synthetic rubbers, is a near-ubiquitous feature of the power amplification mechanisms used by jumping insects. Catapult-like mechanisms, which incorporate elastic energy stores formed from a composite of stiff cuticle and resilin, are frequently used by insects to translate slow muscle contractions into rapid-release recoil movements. The precise role of resilin in these jumping mechanisms remains unclear, however.
View Article and Find Full Text PDFPLoS Comput Biol
December 2024
Department of Psychology, Philipps-Universität Marburg, Marburg, Hesse, Germany.
Accurate navigation often requires the maintenance of a robust internal estimate of heading relative to external surroundings. We present a model for angular velocity integration in a desert locust heading circuit, applying concepts from early theoretical work on heading circuits in mammals to a novel biological context in insects. In contrast to similar models proposed for the fruit fly, this circuit model uses a single 360° heading direction representation and is updated by neuromodulatory angular velocity inputs.
View Article and Find Full Text PDFEnter search terms and have AI summaries delivered each week - change queries or unsubscribe any time!