Publications by authors named "Xinru Lv"

The carboxymethyl chitosan (CMCS)-based porous beads are still criticized for their limited number of binding sites, which impairs their efficacy in removing aqueous pollutants. To overcome this challenge, this work introduces the production of covalently crosslinked CMCS-based beads containing SiO and poly(2-acrylamido-2-methylpropanesulfonic acid) (PAMPS). The porous composite beads not only possess remarkable stability under acidic conditions, but also have abundant active binding sites for adsorption.

View Article and Find Full Text PDF

Safely and effectively harnessing innate immunity to boost cancer immunotherapy is promising yet challenging. Hence, we have developed a series of programmable aptamer-based multispecific engagers by encoding various artificial aptamer-drug codons with DNA-templated polymerization, aiming to broadly boost innate and adaptive immunity for antitumor therapy. All circular single-stranded multivalent aptamer-drug conjugates (os-mvApDCs) had a dendritic structure, precise size, and excellent stability, enabling prolonged blood circulation, targeted tumor accumulation, and rapid multireceptor-mediated endocytosis.

View Article and Find Full Text PDF

Pseudorabies virus (PRV), known to infect pigs and found in various species, including humans, shows zoonotic potential. This study identified vimentin (VIM), a highly conserved intermediate filament protein expressed in multiple mammalian species and tissues, as a universal receptor for PRV infections in human and porcine cells. The adsorption of PRV is positively correlated with the level of VIM expressed in different cells.

View Article and Find Full Text PDF

Double B-box (DBB) proteins are plant-specific transcription factors (TFs) that play crucial roles in plant growth and stress responses. This study investigated the classification, structure, conserved motifs, chromosomal locations, cis-elements, duplication events, expression levels, and protein interaction network of the DBB TF family genes in common wheat ( L.).

View Article and Find Full Text PDF

Multispecific therapeutics hold significant promise in drug delivery, protein degradation, and cell recruitment to address clinical issues of tumor heterogeneity, resistance, and immune evasion. However, their modular engineering remains challenging. We developed a targeted degradation platform, termed multivalent nanobody-targeting chimeras (mNbTACs), by encoding diverse nanobody codons on a circular template using DNA printing technology.

View Article and Find Full Text PDF

This study elucidated the unique pathological features of tissue healing by magnamosis and revealed the changes in landmark molecule expression levels related to collagen synthesis and tissue hypoxia. Forty-eight male Sprague-Dawley rats were divided into the magnamosis and suture anastomosis groups, and gastrojejunal anastomosis surgery was performed. Rats were dissected at 6, 24, and 48 h and 5, 6, 8, 10, and 12 days postoperatively.

View Article and Find Full Text PDF

Porcine circoviruses (PCVs) contain four types: PCV1, PCV2, PCV3, and PCV4, all of which can infect pigs. Among them, PCV1 is non-pathogenic, and PCV2 can cause porcine circovirus diseases (PCVD) or porcine circovirus-associated diseases (PCVAD). Although the pathogenicity of PCV3 and PCV4 is still controversial, increasing evidence shows that PCV3 and PCV4 can cause PCV-related disease.

View Article and Find Full Text PDF

H6 avian influenza virus is widely prevalent in wild birds and poultry and has caused human infection in 2013 in Taiwan, China. During our active influenza surveillance program in wild waterfowl at Poyang Lake, Jiangxi Province, an H6N2 AIV was isolated and named A/bean goose/JiangXi/452-4/2013(H6N2). The isolate was characterized as a typical low pathogenic avian influenza virus (LPAIV) due to the presence of the amino acid sequence PQIETR↓GLFGAI at the cleavage site of the hemagglutinin (HA) protein.

View Article and Find Full Text PDF

Porcine circovirus 4 (PCV4) is a newly identified virus belonging to PCV of the family, the genus. We previously found that PCV4 is pathogenic in vitro, while the virus's replication in cells is still unknown. In this study, we evaluated the N-terminal of the PCV4 capsid (Cap) and identified an NLS at amino acid residues 4-37 of the N-terminus of the PCV4 Cap, RSRYSRRRRNRRNQRRRGLWPRASRRRYRWRRKN.

View Article and Find Full Text PDF

Protocadherin 8 (PCDH8), a calcium-dependent transmembrane protein in the protocadherin family, regulates cell adhesion and signal transduction. While some studies have provided indirect evidence that PCDH8 has cancer-promoting properties, this association is controversial. In particular, its involvement in thyroid cancer (THCA) remains unclear.

View Article and Find Full Text PDF

H10 subtype avian influenza viruses (AIVs) have been isolated from wild and domestic avian species worldwide and have occasionally crossed the species barrier to mammalian hosts. Fatal human cases of H10N8 infections and the recent detection of human H10N3 infections have drawn widespread public attention. In this study, 25 H10Nx viruses were isolated from wild waterfowl in China during a long-term surveillance of AIVs.

View Article and Find Full Text PDF

A modified QuEChERS method coupled with high performance liquid chromatography-tandem mass spectrometry (HPLC-MS/MS) was established for residue analysis of 39 pollutants (34 commonly used multi-class pesticides and 5 metabolites) in medlar matrices (fresh, dried, and medlar juice). Samples were extracted using water with 0.1 % formic acid: acetonitrile (5: 10, v/v).

View Article and Find Full Text PDF

High-fat diet- (HFD-) induced neuroinflammation may ultimately lead to an increased risk of cognitive impairment. Here, we evaluate the effects of diet control and swimming or both on the prevention of cognitive impairment by enhancing SIRT1 activity. Twenty-week-old ApoE-/- mice were fed a HFD for 8 weeks and then were treated with diet control and/or swimming for 8 weeks.

View Article and Find Full Text PDF

Wheat coleoptile is a sheath-like structure that helps to deliver the first leaf from embryo to the soil surface. Here, a RIL population consisting of 245 lines derived from Zhou 8425B × Chinese Spring cross was genotyped by the high-density Illumina iSelect 90K assay for coleoptile length (CL) QTL mapping. Three QTL for CL were mapped on chromosomes 2BL, 4BS and 4DS.

View Article and Find Full Text PDF

Forchlorfenuron (CPPU) is a plant growth regulator widely applied on kiwifruit to improve yield, however, there are rarely reports on its effects on the nutrients of kiwifruits. Based on UHPLC-Q-TOF-MS, the effects of CPPU on metabolism profile and nutrient substances of two kiwifruit varieties during development were investigated by non-targeted metabolomics. A total of 115 metabolites were identified, and 29 differential metabolites were confirmed and quantified using certified reference standards.

View Article and Find Full Text PDF

Disturbance of the internal environment in the spinal cord after spinal cord injury (SCI) is an important cause of the massive death of neurons in the injury area and one of the major problems that lead to the difficult recovery of motor function in patients. , a famous traditional Chinese medicine, is commonly used in neurodegenerative diseases, whereas an iridoid glycoside extract of catalpol (CAT), with antioxidant, antiapoptotic, and neuroprotective pharmacological effects. However, the neuroprotective and anti-apoptosis mechanism of CAT in SCI remains unclear.

View Article and Find Full Text PDF
Article Synopsis
  • In October 2020, 13 cases of a highly pathogenic strain of avian influenza A(H5N8) were found in wild ducks in Ningxia, China.
  • These identified viruses were similar to H5N8 strains that were primarily present in European poultry earlier that year.
  • Researchers also tracked the movement of the infected wild ducks and gathered evidence showing how the virus was spreading.
View Article and Find Full Text PDF
Article Synopsis
  • Researchers isolated highly pathogenic avian influenza viruses H5N8 and H5N1 from migratory birds and fecal samples in Tibet, China, in May 2021.
  • Phylogenetic analyses suggest the viruses may have spread from migratory birds' wintering grounds in South Asia, highlighting the complex interactions between different viral populations.
  • The study emphasizes the need for increased surveillance of avian influenza in these regions and calls for stronger international collaboration to address potential outbreaks.
View Article and Find Full Text PDF

In recent years, the emerging highly pathogenic avian influenza (HPAI) A(H5N8) virus has been reported with features of widely spread, an expanding host range, and cross-species transmission, attracting wide attention. The domestic duck plays a major role in the epidemiological cycle of the HPAI H5N8 virus, but little is known concerning innate immune responses during influenza infection in duck species. In this study, we used two wild-bird-origin viruses, H5N8 and H4N6, to conduct duck infection experiments, and detect the load of the two viruses, and retinoic acid-inducible gene I (RIG-I) and interferon β (IFN-β) in the host's natural immune response.

View Article and Find Full Text PDF

A rapid and sensitive analytical method for determination of pyraclostrobin and thifluzamide in cowpea was established based on QuEChERS sample preparation and liquid chromatography-tandem mass spectrometry (LC-MS/MS). Average recoveries of pyraclostrobin and thifluzamide on cowpea were 100%-105% and 99%-105% with RSDs of 1%-5% and 2%-6%, respectively. The storage stability tests showed degradation rates of < 20% for samples stored at - 18℃ within 12 weeks.

View Article and Find Full Text PDF

Trifloxystrobin (TFS) is a widely used strobilurin fungicide and its residues accumulating in animal-derived food could result in potential harm to consumers. By optimization of extraction solvents and cleanup sorbents, a residue analysis method for TFS and its metabolite trifloxystrobin acid (TFSA) was established in milk, eggs and pork based on QuEChERS sample preparation and LC-MS/MS. The calibration curves exhibited good linearity with determination coefficients (R ) >0.

View Article and Find Full Text PDF
Article Synopsis
  • Highly pathogenic influenza A(H5N8) viruses pose a serious public health threat as they can infect humans and have caused multiple outbreaks in birds globally.
  • Following the detection of H5N8 in swans in Inner Mongolia, researchers monitored swan migration routes in central China and isolated 42 avian influenza viruses, predominantly H5N8.
  • Phylogenetic and phylogeographic analyses revealed that H5N8 viruses from swans in central China share a common evolutionary source, with one sub-clade likely originating from Russian poultry, indicating swans' role in the virus's spread.
View Article and Find Full Text PDF
Article Synopsis
  • A 2-year study in Dandong, China, monitored influenza A viruses in migratory birds, isolating 27 viruses from various subtypes, including multiple samples of H7N4, indicating a potential public health risk.
  • The novel reassortant influenza A(H7N4) virus was identified in both a woman and her poultry, showing varying virulence in mice, which raises concerns for other mammals, including humans.
  • The study emphasizes the urgent need for ongoing surveillance of avian influenza in migratory birds and domestic poultry to manage public health threats, especially given the H7 subtype's ability to infect humans and increase pathogenicity.
View Article and Find Full Text PDF

Blood brain barrier (BBB) dysfunction developed with aging is related to brain microvascular endothelial cells (BMECs) injury and losses of tight junctions (TJs). In the present study, we found that Alisol A 24-acetate (AA), a natural compound frequently used as treatment against vascular diseases was essential for BMECs injury and TJs degradation. Our experimental results showed that AA enhanced cell viability and increased zonula occludens-1 (ZO-1), claudin-5, and occludin expression in the oxygen-glucose deprivation (OGD)-induced BMECs.

View Article and Find Full Text PDF
Article Synopsis
  • In October 2020, two dead swans in Inner Mongolia, China tested positive for highly pathogenic avian influenza A(H5N8).
  • Genetic analysis indicated that these viruses belong to clade 2.3.4.4b.
  • The isolates were found to be similar to H5N8 viruses that were also detected in Eurasia during the same fall of 2020.
View Article and Find Full Text PDF

A PHP Error was encountered

Severity: Warning

Message: fopen(/var/lib/php/sessions/ci_sessionlnjlm6ie2cqpf9jbh4t8urcb3b97mb90): Failed to open stream: No space left on device

Filename: drivers/Session_files_driver.php

Line Number: 177

Backtrace:

File: /var/www/html/index.php
Line: 316
Function: require_once

A PHP Error was encountered

Severity: Warning

Message: session_start(): Failed to read session data: user (path: /var/lib/php/sessions)

Filename: Session/Session.php

Line Number: 137

Backtrace:

File: /var/www/html/index.php
Line: 316
Function: require_once