Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide.

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

Combination of Biogas Residues and Interactions Stimulates Crop Production and Salinity Tolerance in .

Stress tolerance in cereal crops like Sorghum is important to address food security and land development for saline agriculture. Salinity is considered one of the most devastating abiotic stresses affecting plant growth and yield, specifically in water-scared areas of the world. Biogas residue is a good source of plant nutrients with enriched fertilizer for crop yield and productivity.

The induction of polyamines metabolism pathway and membrane stability with silicon alleviate the vanadium toxicity in pepper plants.

The vanadium (V) toxicity predominantly is the primary limitation in restraining pepper growth. The silicon (Si) in pepper plants induced the transcript level of the polyamines metabolism pathway genes, including the arginase (CbARG), ornithine decarboxylase (CbODC), arginine decarboxylase (CbADC), N-carbamoylputrescine amidase (CbNCA), Spermidine synthase (CbSPDS), copper binding diamine oxidase (CbCuAO) to overcome the V toxicity. The polyamines, including the Spm, Spd, and Put, induced with Si about 41.

Scanning of antennae and maxillary palps of anthropophilic and ornithophilic as potential arbovirus vectors.

Background And Aim: Efficient mosquito vectors are required to persist and propagate arthropod-borne diseases that seriously affect impoverished populations worldwide. Mosquito sensilla plays a crucial role in host-seeking and disease transmission to humans. This study aimed to distinguish between the several types of sensilla found on the antennae and maxillary palps of and , matching this diversity with host preference and disease transmission.

Integrated physiological, transcriptomic, and metabolomic investigation reveals that MgO NPs mediate the alleviation of cadmium stress in tobacco seedlings through ABA-regulated lignin synthesis.

The harmful influence caused by cadmium (Cd) to agriculture is severe and enduring. Efforts to reduce the damage by Cd to crop is an important topic. In this study, we investigated the effect of MgO NPs on tobacco seedlings' growth under Cd stress and explored its mechanism.

Endoscopic Fat Graft Myringoplasty Augmented With Hyaluronic Acid for Managing Large-Sized Eardrum Perforations; A Prospective Comparative Randomised Study.

Objectives: We aimed to assess the outcomes of fat graft myringoplasty augmented with hyaluronic acid in closing large-sized eardrum perforations compared to the traditional underlay cartilage-perichondrium composite myringoplasty (CPCM).

Study Design: It was a prospective randomised comparative study.

Settings: It was held in tertiary referral institutions between May 2020 and April 2022.

Effect of soft tissue thickness on accuracy of conventional and digital implant impression techniques.

Background: Placing implants deep sub-gingivally may affect the accuracy of implant impression techniques and the fit of final restoration.

Purpose: The aim of this in-vitro study was to evaluate the effect of soft tissue thickness on accuracy of conventional and digital implant impression techniques.

Methods: Four parallel implant analogues (A, B, C, D) placed in each of two epoxy resin models representing edentulous mandible covered by flexible polyurethane material with two different thickness two mm and four mm.

Impact of iron sulfate (FeSO) foliar application on growth, metabolites and antioxidative defense of Luffa cylindrica (Sponge gourd) under salt stress.

Salt stress is becoming a major issue for the world's environment and agriculture economy. Different iron [Fe] sources can give an environmentally friendly alternative for salt-affected soil remediation. In this study the effects of Iron sulfate on Luffa cylindrica (Sponge gourd) cultivated in normal and saline water irrigated soil were examined.

Improving maize yield and drought tolerance in field conditions through activated biochar application.

Amidst depleting water resources, rising crop water needs, changing climates, and soil fertility decline from inorganic modifications of soil, the need for sustainable agricultural solutions has been more pressing. The experimental work aimed to inspect the potential of organically activated biochar in improving soil physicochemical and nutrient status as well as improving biochemical and physiological processes, and optimizing yield-related attributes under optimal and deficit irrigation conditions. Biochar enhances soil structure, water retention, and nutrient availability, while improving plant nutrient uptake and drought resilience.

Incidence and predictors of ventilator-associated pneumonia using a competing risk analysis: a single-center prospective cohort study in Egypt.

Background: Ventilator-associated pneumonia (VAP) is a challenging nosocomial problem in low- and middle-income countries (LMICs) that face barriers to healthcare delivery and resource availability. This study aimed to examine the incidence and predictors of VAP in Egypt as an example of an LMIC while considering death as a competing event.

Methods: The study included patients aged ≥ 18 years who underwent mechanical ventilation (MV) in an intensive care unit (ICU) at a tertiary care, university hospital in Egypt between May 2020 and January 2023.

Comprehensive transcriptome, physiological and biochemical analyses reveal that key role of transcription factor WRKY and plant hormone in responding cadmium stress.

Cadmium (Cd) is readily absorbed by tobacco and accumulates in the human body through smoke inhalation, posing threat to human health. While there have been many studies on the negative impact of cadmium in tobacco on human health, the specific adaptive mechanism of tobacco roots to cadmium stress is not well understood. In order to comprehensively investigate the effects of Cd stress on the root system of tobacco, the combination of transcriptomic, biochemical, and physiological methods was utilized.

Silicon improves salt resistance by enhancing ABA biosynthesis and aquaporin expression in Nicotiana tabacum L.

Silicon (Si) can significantly improve the salt tolerance of plants, but its mechanism remains unclear. In this study, role of abscisic acid (ABA) in Si derived salt resistance in tobacco seedling was investigated. Under salt stress, the photosynthetic rate, stomatal conductance, and transpiration rate of tobacco seedlings were reduced by 86.

Radiofrequency Versus CO Laser in Posterior Cordotomy for Managing Bilateral Abductor Vocal Fold Immobility.

Purpose: This study aimed to assess the outcomes of posterior cordotomy in cases with bilateral abductor vocal fold immobility (BAVFI), either by radiofrequency or CO laser.

Methods: This prospective comparative randomized study included 80 patients with BAVFI of different etiologies. They were divided randomly into two groups.

Supplemental Sodium Nitroprusside and Spermidine Regulate Water Balance and Chlorophyll Pigments to Improve Sunflower Yield under Terminal Drought.

Drought is an inevitable environmental stress that drastically hampers the growth, productivity, and quality of food crops. Exogenous sodium nitroprusside and spermidine have decisive functions in the growth enhancement of plants; nevertheless, their specific role in mediating stress responses to improve drought tolerance in sunflowers at the reproductive stage (terminal drought) remains largely unknown. In the present study, we explored the positive effects of sodium nitroprusside and spermidine on physiological responses to increase in sunflower yield during periods of terminal drought.

Design of silver-zinc-nickel spinel-ferrite mesoporous silica as a powerful and simply separable adsorbent for some textile dye removal.

Silver-zinc-nickel spinel ferrite was prepared by the co-precipitation procedure with the precise composition AgZnNiFeO for bolstering pollutant removal effectiveness while upholding magnetic properties and then coated with a mesoporous silica layer. The surface characteristics and composition of AgZnNiFeO@mSiO were confirmed using EDX, FT-IR, VSM, XRD, TEM, SEM, and BET methods. The surface modification of Ag-Zn-Ni ferrite with a silica layer improves the texture properties, where the specific surface area and average pore size of the spinel ferrite rose to 180 m/g and 3.

Evaluation of the accuracy of conventional and digital implant impression techniques in bilateral distal extension cases: a randomized clinical trial.

Background: This clinical study aims to evaluate the accuracy of the conventional implant impression techniques compared to the digital impression ones in bilateral distal extension cases.

Methods: A total of 32 implants were placed in eight patients missing all mandibular posterior teeth except the first premolars. Each patient received a total of four implants, with two implants placed on each side, in order to provide support for three units of screw-retained zirconia restorations.

Effect of temperature on the biological parameters of pink bollworm, Pectinophora gossypiella Saunders (Lepidoptera: Gelechiidae).

Pink bollworm (PBW) Pectinophora gossypiella is an important pest cotton worldwide. There are multiple factors which determines the occurrence and distribution of P. gossypiella across different cotton growing regions of the world, and one such key factor is 'temperature'.