Fullerenol nanoparticles and AMF application for optimization of Brassica napus L. resilience to lead toxicity through physio-biochemical and antioxidative modulations.

Crop plants are severely affected by heavy metals (HMs), leading to food scarcity and economical loss. Lead (Pb) is outsourced by use of lead-based fertilizers, batteries, mining, smelting and metal processing. It significantly reduces growth, development and yield of crops cultivated on contaminated sites.

Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide.

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

Combination of Biogas Residues and Interactions Stimulates Crop Production and Salinity Tolerance in .

Stress tolerance in cereal crops like Sorghum is important to address food security and land development for saline agriculture. Salinity is considered one of the most devastating abiotic stresses affecting plant growth and yield, specifically in water-scared areas of the world. Biogas residue is a good source of plant nutrients with enriched fertilizer for crop yield and productivity.

The induction of polyamines metabolism pathway and membrane stability with silicon alleviate the vanadium toxicity in pepper plants.

The vanadium (V) toxicity predominantly is the primary limitation in restraining pepper growth. The silicon (Si) in pepper plants induced the transcript level of the polyamines metabolism pathway genes, including the arginase (CbARG), ornithine decarboxylase (CbODC), arginine decarboxylase (CbADC), N-carbamoylputrescine amidase (CbNCA), Spermidine synthase (CbSPDS), copper binding diamine oxidase (CbCuAO) to overcome the V toxicity. The polyamines, including the Spm, Spd, and Put, induced with Si about 41.

Integrated physiological, transcriptomic, and metabolomic investigation reveals that MgO NPs mediate the alleviation of cadmium stress in tobacco seedlings through ABA-regulated lignin synthesis.

The harmful influence caused by cadmium (Cd) to agriculture is severe and enduring. Efforts to reduce the damage by Cd to crop is an important topic. In this study, we investigated the effect of MgO NPs on tobacco seedlings' growth under Cd stress and explored its mechanism.

Impact of iron sulfate (FeSO) foliar application on growth, metabolites and antioxidative defense of Luffa cylindrica (Sponge gourd) under salt stress.

Salt stress is becoming a major issue for the world's environment and agriculture economy. Different iron [Fe] sources can give an environmentally friendly alternative for salt-affected soil remediation. In this study the effects of Iron sulfate on Luffa cylindrica (Sponge gourd) cultivated in normal and saline water irrigated soil were examined.

Improving maize yield and drought tolerance in field conditions through activated biochar application.

Amidst depleting water resources, rising crop water needs, changing climates, and soil fertility decline from inorganic modifications of soil, the need for sustainable agricultural solutions has been more pressing. The experimental work aimed to inspect the potential of organically activated biochar in improving soil physicochemical and nutrient status as well as improving biochemical and physiological processes, and optimizing yield-related attributes under optimal and deficit irrigation conditions. Biochar enhances soil structure, water retention, and nutrient availability, while improving plant nutrient uptake and drought resilience.

Comprehensive transcriptome, physiological and biochemical analyses reveal that key role of transcription factor WRKY and plant hormone in responding cadmium stress.

Cadmium (Cd) is readily absorbed by tobacco and accumulates in the human body through smoke inhalation, posing threat to human health. While there have been many studies on the negative impact of cadmium in tobacco on human health, the specific adaptive mechanism of tobacco roots to cadmium stress is not well understood. In order to comprehensively investigate the effects of Cd stress on the root system of tobacco, the combination of transcriptomic, biochemical, and physiological methods was utilized.

Silicon improves salt resistance by enhancing ABA biosynthesis and aquaporin expression in Nicotiana tabacum L.

Silicon (Si) can significantly improve the salt tolerance of plants, but its mechanism remains unclear. In this study, role of abscisic acid (ABA) in Si derived salt resistance in tobacco seedling was investigated. Under salt stress, the photosynthetic rate, stomatal conductance, and transpiration rate of tobacco seedlings were reduced by 86.

Supplemental Sodium Nitroprusside and Spermidine Regulate Water Balance and Chlorophyll Pigments to Improve Sunflower Yield under Terminal Drought.

Drought is an inevitable environmental stress that drastically hampers the growth, productivity, and quality of food crops. Exogenous sodium nitroprusside and spermidine have decisive functions in the growth enhancement of plants; nevertheless, their specific role in mediating stress responses to improve drought tolerance in sunflowers at the reproductive stage (terminal drought) remains largely unknown. In the present study, we explored the positive effects of sodium nitroprusside and spermidine on physiological responses to increase in sunflower yield during periods of terminal drought.

Effect of temperature on the biological parameters of pink bollworm, Pectinophora gossypiella Saunders (Lepidoptera: Gelechiidae).

Pink bollworm (PBW) Pectinophora gossypiella is an important pest cotton worldwide. There are multiple factors which determines the occurrence and distribution of P. gossypiella across different cotton growing regions of the world, and one such key factor is 'temperature'.

Aquaporin mediated silicon-enhanced root hydraulic conductance is benefit to cadmium dilution in tobacco seedlings.

Numerous studies shown that silicon (Si) enhanced plants' resistance to cadmium (Cd). Most studies primarily focused on investigating the impact of Si on Cd accumulation. However, there is a lack of how Si enhanced Cd resistance through regulation of water balance.

Variety-dependent responses of common tobacco with differential cadmium resistance: Cadmium uptake and distribution, antioxidative activity, and gene expression.

Cadmium (Cd), which accumulates in tobacco leaves, enters the human body through inhalation of smoke, causing harmful effects on health. Therefore, identifying the pivotal factors that govern the absorption and resistance of Cd in tobacco is crucial for mitigating the harmful impact of Cd. In the present study, four different Cd-sensitive varieties, namely, ZhongChuan208 (ZC) with resistance, ZhongYan100 (ZY), K326 with moderate resistance, and YunYan87 (YY) with sensitivity, were cultivated in hydroponic with different Cd concentrations (20 µM, 40 µM, 60 µM and 80 µM).

Elicitation of salicylic acid and methyl jasmonate provides molecular and physiological evidence for potato susceptibility to infection by subsp. .

Among the range of severe plant diseases, bacterial soft rot caused by is a significant threat to crops. This study aimed to examine the varying response patterns of distinct potato cultivars to the influence of . Furthermore, it seeks to highlight the potential role of salicylic acid (SA) and methyl jasmonate (MeJA) in stimulating the antioxidant defence system.

New reports of pathogen spectrum associated with bulb rot and their interactions during the development of rot in tulip.

Bulb rot, a highly damaging disease of tulip plants, has hindered their profitable cultivation worldwide. This rot occurs in both field and storage conditions posing significant challenges. While this disease has been attributed to a range of pathogens, previous investigations have solely examined it within the framework of a single-pathogen disease model.

Machine learning assisted designing of non-fullerene electron acceptors: A quest for lower exciton binding energy.

The designing of acceptors materials for the organic solar cells is a hot topic. The normal experimental methods are tedious and expensive for large screening. Machine learning guided exploration is more suitable solution.

Potential of melatonin and Trichoderma harzianum inoculation in ameliorating salt toxicity in watermelon: Insights into antioxidant system, leaf ultrastructure, and gene regulation.

Melatonin (MT) is an extensively studied biomolecule with dual functions, serving as an antioxidant and a signaling molecule. Trichoderma Harzianum (TH) is widely recognized for its effectiveness as a biocontrol agent against many plant pathogens. However, the interplay between seed priming and MT (150 μm) in response to NaCl (100 mM) and its interaction with TH have rarely been investigated.

Insights into the alleviation of cadmium toxicity in rice by nano-zinc and Serendipita indica: Modulation of stress-responsive gene expression and antioxidant defense system activation.

The adversities of cadmium (Cd) contamination are quite distinguished among other heavy metals (HMs), and so is the efficacy of zinc (Zn) nutrition in mitigating Cd toxicity. Rice (Oryza sativa) crop, known for its ability to absorb HMs, inadvertently facilitates the bioaccumulation of Cd, posing a significant risk to both the plant itself and to humans consuming its edible parts, and damaging the environment as well. The use of nanoparticles, such as nano-zinc oxide (nZnO), to improve the nutritional quality of crops and combat the harmful effects of HMs, have gained substantial attention among scientists and farmers.

Mycorrhizosphere bacteria inhibit greenhouse gas emissions from microplastics contaminated soil by regulating soil enzyme activities and microbial community structure.

Microplastics (MPs) accumulation in terrestrial ecosystems can affect greenhouse gases (GHGs) production by altering microbial and soil structure. Presently, research on the MPs effect on plants is not consistent, and underlying molecular mechanisms associated with GHGs are yet unknown. For the first time, we conducted a microcosm study to explore the impact of MPs addition (Raw vs.

Interaction of titanium dioxide nanoparticles with PVC-microplastics and chromium counteracts oxidative injuries in Trachyspermum ammi L. by modulating antioxidants and gene expression.

The emergence of polyvinyl chloride (PVC) microplastics (MPs) as pollutants in agricultural soils is increasingly alarming, presenting significant toxic threats to soil ecosystems. Ajwain (Trachyspermum ammi L.), a plant of significant medicinal and culinary value, is increasingly subjected to environmental stressors that threaten its growth and productivity.