Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide.

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

Combination of Biogas Residues and Interactions Stimulates Crop Production and Salinity Tolerance in .

Stress tolerance in cereal crops like Sorghum is important to address food security and land development for saline agriculture. Salinity is considered one of the most devastating abiotic stresses affecting plant growth and yield, specifically in water-scared areas of the world. Biogas residue is a good source of plant nutrients with enriched fertilizer for crop yield and productivity.

Diagnostic Accuracy of Cranial Ultrasound for the Detection of Intracranial Hemorrhage in Preterm Neonates Using Magnetic Resonance Imaging As the Gold Standard.

Background and objective Intracranial hemorrhage (ICH) and white-matter damage are the main brain injuries in preterm infants. Magnetic resonance imaging (MRI) is the best way to examine cerebral bleeding. The evidence on cranial ultrasound diagnostic accuracy in neonates is limited in Pakistani publications, which show variability in evidence, necessitating the present study.

Digital dermatitis in dairy cattle in Egypt: Herd-level risk factors and Treponema spp. prevalence across lesion M-scores.

Digital dermatitis (DD) is an infectious disease of the digital skin of dairy cows that is associated with compromised animal welfare and significant economic losses. The hind feet of 16,098 dairy cows from 55 herds were examined in the milking parlor, and DD lesions identified were classified using the M-score system and swabbed for PCR testing. Swabs were also collected from hind feet with normal digital skin for comparison.

Impact of daily neighborhood crime on nightly sleep among adolescents.

Crime impacts both the immediate victims and has indirect effects on the community. This study examined associations between daily neighborhood crime and actigraphy-assessed sleep outcomes using multilevel modeling. Data were from a longitudinal (14-day) study of 288 adolescents (M = 15.