Discrimination (unfair treatment due to group membership) is relatively common among adolescents and has been linked to poor sleep and physical health. Individual differences in physiological functioning may moderate these associations. A sample of 323 youth (48% boys, 52% girls; 58.
View Article and Find Full Text PDFOpen Vet J
November 2024
Background: Infectious bovine rhinotracheitis (IBR) is a global contagious respiratory disease of ruminants caused by Bovine Herpes virus-1 (BoHV-1). It causes substantial financial losses in the dairy industry worldwide and is considered one of the most important causative agents of abortion and reproductive problems in dairy cattle.
Aim: This study aimed to estimate the seroprevalence of IBR and the related risk factors in the dairy population in Gharbia governorate, Egypt.
Crop plants are severely affected by heavy metals (HMs), leading to food scarcity and economical loss. Lead (Pb) is outsourced by use of lead-based fertilizers, batteries, mining, smelting and metal processing. It significantly reduces growth, development and yield of crops cultivated on contaminated sites.
View Article and Find Full Text PDFThe increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFStress tolerance in cereal crops like Sorghum is important to address food security and land development for saline agriculture. Salinity is considered one of the most devastating abiotic stresses affecting plant growth and yield, specifically in water-scared areas of the world. Biogas residue is a good source of plant nutrients with enriched fertilizer for crop yield and productivity.
View Article and Find Full Text PDF