Background And Aims: Survey based studies show a high prevalence of endoscopy related injury (ERI). This survey aims to provide data regarding the type of design changes to the colonoscope that would be most beneficial for gastroenterologists and facilitate user-centered design changes.
Methods: A 26-item anonymous, electronic, multiple-choice survey was answered by 455 gastroenterologists.
World J Pediatr Congenit Heart Surg
January 2025
Background: Survival beyond one month of age is rare in children born with obstructed infracardiac total anomalous pulmonary venous connection (TAPVC). There are limited data available on surgical outcomes of the same subset. We conducted this retrospective study to identify risk factors associated with surgical outcomes in this patient population.
View Article and Find Full Text PDFBackground: Colorectal cancer (CRC) is a complex and increasingly prevalent malignancy with significant challenges in its treatment and prognosis. This study aims to explore the role of the SLC4A4 transporter as a biomarker in CRC progression and its potential as a therapeutic target, particularly in relation to tumor acidity and immune response.
Methods: The study utilized computational approaches, including receptor-based virtual screening and high-throughput docking, to identify potential SLC4A4 inhibitors.
Background: The concomitant hiatal hernia repair with endoscopic fundoplication (c-TIF) is a novel anti-reflux procedure that addresses the hiatus and the gastro-esophageal flap valve for surgical candidates with GERD. We aim to compare the outcomes of a hiatal hernia repair with endoscopic fundoplication (TIF) vs surgical partial fundoplication (anterior and posterior) with regards to quality-of-life scores at 12 months after surgery.
Study Design: Following IRB approval, a prospectively maintained anti-reflux database was retrospectively reviewed to identify patients who underwent a c-TIF procedure or a surgical hiatal hernia repair with partial fundoplication.
Post-stroke cognitive impairment is a common consequence of stroke, characterized by deficits in language, cognitive functioning, functional abilities. Innovative technological approaches, such as computerized cognitive retraining, offer promising strategies for mitigating the cognitive challenges. Despite their potential, the impact of these interventions on neuropsychological function and daily living capabilities has poor outcomes.
View Article and Find Full Text PDFWe present a case of an adult patient with a large symptomatic fusiform basilar artery aneurysm. This video demonstrates the ease of deploying the new Pipeline™ Vantage Flow Diverter compared to the Flex model in the same vessel. The Flex and Vantage have different deployment techniques-as using the Flex maneuvering technique on the Vantage may damage the braid.
View Article and Find Full Text PDFThe increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.
View Article and Find Full Text PDFThis study investigated the effect of various levels of OH-MWCNTs mediated seed priming on germination, growth, and biochemical responses of Indian mustard (Brassica juncea (L.) Czern. & Coss.
View Article and Find Full Text PDFEsophageal squamous cell carcinoma (ESCC) remains a significant global health challenge, being the sixth leading cause of cancer mortality with pronounced geographic variability. The incidence rates range from 125 per 100,000 in northern China to 1-1.5 per 100,000 in the United States, driven by environmental and lifestyle factors such as tobacco and alcohol use, dietary habits, and pollution.
View Article and Find Full Text PDFThe occurrence of cutaneous metastasis from internal malignancies is relatively rare. Furthermore, cutaneous metastasis from gallbladder carcinoma is an infrequent phenomenon, with only a few reported cases. Here, we report a case of a 45-year-old male with cutaneous metastasis from primary gallbladder carcinoma, initially presenting solely with a scrotal lesion.
View Article and Find Full Text PDFA 62-year-old lady was referred with the diagnosis of hypertensive encephalopathy. She had episodes of paroxysms of hypertension while on the ventilator with normal saturations. She underwent a battery of tests to identify the cause of the paroxysms.
View Article and Find Full Text PDFGlobal obesity rates have risen dramatically, now exceeding deaths from starvation. Metabolic and bariatric surgery (MBS), initially for severe obesity (BMI ≥35 kg/m), is performed globally over 500 000 times annually, offering significant metabolic benefits beyond weight loss. However, varying eligibility criteria globally impact patient care and healthcare resources.
View Article and Find Full Text PDFBacteria possess hair-like projections on their surface termed pili. The primary function of a pilus is to enable bacterial cell attachment to the host. Since pili are associated with cell adhesion, they play a major role in bacterial colonization and infection.
View Article and Find Full Text PDFThis is a case report of a previously healthy 26-year-old female with unexplained neurological symptoms that eventually developed malignant catatonia. Because malignant catatonia has a range of clinical manifestations, making prompt diagnosis a challenging task. Due to her relapsing symptoms, the patient was admitted to the inpatient psychiatric unit three times in less than 2 months, and eventually recovered with high doses of lorazepam and several electroconvulsive therapy (ECT) treatments after a stay in the intensive care unit (ICU).
View Article and Find Full Text PDFManagement of neuropathic pain is exceptionally challenging and development of new drugs and ways to optimize treatment effects in clinical practice are needed. Over the last decade, some of the mechanisms underlying placebo effects have been elucidated and some of the insights have the potential to improve the treatment for neuropathic pain. Research suggests that the increasing placebo responses observed in randomized controlled trials (RCTs) for neuropathic pain pose challenges for the development and availability of new effective pain medications.
View Article and Find Full Text PDFJ Stroke Cerebrovasc Dis
January 2025
Background: There is a lack of substantial evidence supporting the safety and effectiveness of endovascular thrombectomy in treating distal medium vessel occlusions (DMVOs).
Objective: To summarize the current evidence regarding endovascular thrombectomy for DMVOs.
Methods: We conducted a narrative review of key articles related to the diagnosis and management of DMVOs.
Endoscopic ultrasound-guided radiofrequency ablation (EUS-RFA) has emerged as an effective and minimally invasive treatment for pancreatic lesions, particularly in patients at high surgical risk. Utilizing thermal energy, RFA induces the coagulative necrosis of the tissue and potentially triggers immunomodulation by releasing intracellular antigens. Numerous studies have confirmed the technical feasibility, safety, and efficacy of EUS-RFA in pancreatic neuroendocrine tumors and premalignant cystic lesions, with an acceptable profile of adverse events.
View Article and Find Full Text PDFBackground: Rapid prehospital identification of acute ischemic stroke secondary to large vessel occlusions (AIS-LVO) has been successful in triaging patients, but the use of stroke screening scales often varies. This study aims to compare different stroke screening scales for the detection of anterior and posterior circulation AIS-LVO and AIS secondary to medium vessel occlusions (AIS-MeVO).
Methods: We prospectively analyzed stroke alert activations at a comprehensive stroke center between August 1, 2022 and December 31, 2023.
Background: Acute ischemic stroke (AIS) due to intracranial atherosclerotic disease (ICAD) carries a high risk of recurrence despite aggressive medical management. The aim of our study is to present our initial experience with the Onyx Frontier™ balloon-mounted drug-eluting stent (Medtronic, Santa Rosa, CA) for AIS due to ICAD.
Methods: We conducted a multicenter retrospective cohort study describing the technical feasibility, safety, and performance of using the Onyx Frontier™ balloon-mounted drug-eluting stent in patients with acute intracranial vessel occlusion due to ICAD across three comprehensive stroke centers in the United States.