Short message service usage may improve the public's self-health management: A community-based randomized controlled study.

Background And Aims: The last decade has witnessed unprecedented growth in mobile phone use. It links millions of previously unconnected people. The ubiquity of mobile phones, which allows for use of the short message service (SMS), offers new and innovative opportunities for disease prevention and health education.

STA-TSN: Spatial-Temporal Attention Temporal Segment Network for action recognition in video.

Most deep learning-based action recognition models focus only on short-term motions, so the model often causes misjudgments of actions that are combined by multiple processes, such as long jump, high jump, etc. The proposal of Temporal Segment Networks (TSN) enables the network to capture long-term information in the video, but ignores that some unrelated frames or areas in the video can also cause great interference to action recognition. To solve this problem, a soft attention mechanism is introduced in TSN and a Spatial-Temporal Attention Temporal Segment Networks (STA-TSN), which retains the ability to capture long-term information and enables the network to adaptively focus on key features in space and time, is proposed.

Artesunate Provides Neuroprotection against Cerebral Ischemia-Reperfusion Injury via the TLR-4/NF-κB Pathway in Rats.

Inflammation has an important role in ischemia-reperfusion (I/R) injury. Artesunate (ART) has anti-microbial and anti-inflammatory pharmacological activities, and it is used for various types of serious malaria, including cerebral malaria. ART maintains a high concentration in the brain but little is known about the neuroprotective effect of ART against brain I/R injury.

A combined HMM-PCNN model in the contourlet domain for image data compression.

Multiscale geometric analysis (MGA) is not only characterized by multi-resolution, time-frequency localization, multidirectionality and anisotropy, but also outdoes the limitations of wavelet transform in representing high-dimensional singular data such as edges and contours. Therefore, researchers have been exploring new MGA-based image compression standards rather than the JPEG2000 standard. However, due to the difference in terms of the data structure, redundancy and decorrelation between wavelet and MGA, as well as the complexity of the coding scheme, so far, no definitive researches have been reported on the MGA-based image coding schemes.

The research on propagation characteristics of acoustic emission signals in stiffened plates based on the multipath propagation model.

Mechanical equipment with the stiffener has a strong interference with the propagation of acoustic emission (AE) signals from faults, reducing the accuracy of fault detection. This paper conducts an in-depth study of the interaction between AE signals and the stiffener. The installation constraints, that can separate the direct signal, signals scattered from the stiffener and signals reflected from the boundary in the time domain, for sensors are deduced based on the multipath propagation model of AE signals in the stiffened plate.

Protective effect of silencing Stat1 on high glucose-induced podocytes injury via Forkhead transcription factor O1-regulated the oxidative stress response.

Background: Podocyte plays an important role in maintaining the integrity and function of the glomerular filtration barrier. Various studies reported that forkhead transcription factor (Fox) O1 played a key role in anti-oxidative signaling. This study aimed to investigate the role of Stat1 in high glucose (HG) -induced podocyte injury.

Prediction of Fatigue Crack Growth in Gas Turbine Engine Blades Using Acoustic Emission.

Fatigue failure is the main type of failure that occurs in gas turbine engine blades and an online monitoring method for detecting fatigue cracks in blades is urgently needed. Therefore, in this present study, we propose the use of acoustic emission (AE) monitoring for the online identification of the blade status. Experiments on fatigue crack propagation based on the AE monitoring of gas turbine engine blades and TC11 titanium alloy plates were conducted.

Wavelet transform based defringing in interference imaging spectrometer.

The constructive and destructive fringe-like pattern (FP) introduced by the fringing effects is a universal phenomenon emerging in the imaging system using the back-illuminated CCD. Generally, the flat fielding or modeling based methods were applied to suppressing the FP and featured as time-consuming, duplicated, and hardware-based. In this paper, a method based on the wavelet transform was proposed for the interferogram processing in interference imaging spectrometer.

The Identification of the Deformation Stage of a Metal Specimen Based on Acoustic Emission Data Analysis.

The acoustic emission (AE) signals of metal materials have been widely used to identify the deformation stage of a pressure vessel. In this work, Q235 steel samples with different propagation distances and geometrical structures are stretched to get the corresponding acoustic emission signals. Then the obtained acoustic emission signals are de-noised by empirical mode decomposition (EMD), and then decomposed into two different frequency ranges, i.

Cell phone-based health education messaging improves health literacy.

Background: The ubiquity of cell phones, which allow for short message service (SMS), provides new and innovative opportunities for disease prevention and health education.

Objective: To explore the use of cell phone-based health education SMS to improve the health literacy of community residents in China.

Methods: A multi-stage random sampling method was used to select representative study communities and participants ≥ 18 years old.

Prevalence of depressive symptoms and work-related risk factors among nurses in public hospitals in southern China: a cross-sectional study.

Poor mental health among nurses not only hinders professional performance but also affects the quality of healthcare provided. To improve the prevention and management of depression among nurses in mainland China, we investigated the association between working conditions and depressive symptoms using a cross-sectional study with a sample of 3474 nurses with more than 1 year of work experience in public hospitals in Shenzhen in southern China. Participants completed a structured questionnaire and a validated measure of depressive symptoms.

Prevalence of anxiety and depressive symptoms and related risk factors among physicians in China: a cross-sectional study.

Background: Physicians' poor mental health not only hinders their professional performance and affects the quality of healthcare provided but also adversely affects patients' health outcomes. Few studies in China have evaluated the mental health of physicians. The purposes of this study are to quantify Chinese physicians' anxiety and depressive symptoms as well as evaluate associated risk factors.

Effects of muscarinic acetylcholine 3 receptor(208-227) peptide immunization on autoimmune response in nonobese diabetic mice.

The second extracellular loop (LFWQYFVGKRTVPPGECFIQFLSEPTITFGTAI, aa 205-237) of muscarinic acetylcholine 3 receptor (M3R) has been reported to be an epitope for autoantibodies generated during certain autoimmune disorders, including Sjögren's syndrome (SS). Autoantibodies against M3R(228-237) have been shown to interfere with the function of M3R. However, few studies have been performed on the M3R(205-227) peptide of the second extracellular loop.

Effect of Helicobacter pylori infection on gastric mucosal pathologic change and level of nitric oxide and nitric oxide synthase.

Aim: To investigate the level of nitric oxide (NO) and nitrous oxide synthase (NOS) enzyme and its effect on gastric mucosal pathologic change in patients infected with Helicobacter pylori (H pylori), and to study the pathogenic mechanism of H pylori.

Methods: The mucosal tissues of gastric antrum were taken by endoscopy, then their pathology, H pylori and anti-CagA-IgG were determined. Fifty H pylori positive cases and 35 H pylori negative cases were randomly chosen.