Exploring the utility of different bulking agents for speeding up the composting process of household kitchen waste.

Household kitchen waste (HKW) is produced in large quantity and its management is difficult due to high moisture content and complex organic matter. Aerobic composting of HKW is an easy, efficient, cost-effective and eco-friendly method. This study is designed to achieve a zero-waste concept and to convert HKW.

Hormesis effect of cadmium on pakchoi growth: Unraveling the ROS-mediated IAA-sugar metabolism from multi-omics perspective.

Previous research on cadmium (Cd) focused on toxicity, neglecting hormesis and its mechanisms. In this study, pakchoi seedlings exposed to varying soil Cd concentrations (CK, 5, 10, 20, 40 mg/kg) showed an inverted U-shaped growth trend (hormesis characteristics): As Cd concentration increases, biomass exhibited hormesis character (Cd5) and then disappear (Cd40). ROS levels rose in both Cd treatments, with Cd5 being intermediate between CK and Cd40.

Discrimination, sleep, and physical health: Moderation by respiratory sinus arrythmia reactivity.

Discrimination (unfair treatment due to group membership) is relatively common among adolescents and has been linked to poor sleep and physical health. Individual differences in physiological functioning may moderate these associations. A sample of 323 youth (48% boys, 52% girls; 58.

Seroprevalence and risk factors of infectious bovine rhinotracheitis in cattle in Gharbia governorate, Egypt: A comparative study of traditional and commercial production systems.

Background: Infectious bovine rhinotracheitis (IBR) is a global contagious respiratory disease of ruminants caused by Bovine Herpes virus-1 (BoHV-1). It causes substantial financial losses in the dairy industry worldwide and is considered one of the most important causative agents of abortion and reproductive problems in dairy cattle.

Aim: This study aimed to estimate the seroprevalence of IBR and the related risk factors in the dairy population in Gharbia governorate, Egypt.

Fullerenol nanoparticles and AMF application for optimization of Brassica napus L. resilience to lead toxicity through physio-biochemical and antioxidative modulations.

Crop plants are severely affected by heavy metals (HMs), leading to food scarcity and economical loss. Lead (Pb) is outsourced by use of lead-based fertilizers, batteries, mining, smelting and metal processing. It significantly reduces growth, development and yield of crops cultivated on contaminated sites.

Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide.

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from strain IT, identified as the amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, for its efficacy in controlling bacterial wilt (BW) disease in tomato () caused by . Our research demonstrates that foliar application of this AMP at a concentration of 200 ppm significantly reduces disease incidence by 49.

Combination of Biogas Residues and Interactions Stimulates Crop Production and Salinity Tolerance in .

Stress tolerance in cereal crops like Sorghum is important to address food security and land development for saline agriculture. Salinity is considered one of the most devastating abiotic stresses affecting plant growth and yield, specifically in water-scared areas of the world. Biogas residue is a good source of plant nutrients with enriched fertilizer for crop yield and productivity.

Digital dermatitis in dairy cattle in Egypt: Herd-level risk factors and Treponema spp. prevalence across lesion M-scores.

Digital dermatitis (DD) is an infectious disease of the digital skin of dairy cows that is associated with compromised animal welfare and significant economic losses. The hind feet of 16,098 dairy cows from 55 herds were examined in the milking parlor, and DD lesions identified were classified using the M-score system and swabbed for PCR testing. Swabs were also collected from hind feet with normal digital skin for comparison.

Impact of daily neighborhood crime on nightly sleep among adolescents.

Crime impacts both the immediate victims and has indirect effects on the community. This study examined associations between daily neighborhood crime and actigraphy-assessed sleep outcomes using multilevel modeling. Data were from a longitudinal (14-day) study of 288 adolescents (M = 15.

The induction of polyamines metabolism pathway and membrane stability with silicon alleviate the vanadium toxicity in pepper plants.

The vanadium (V) toxicity predominantly is the primary limitation in restraining pepper growth. The silicon (Si) in pepper plants induced the transcript level of the polyamines metabolism pathway genes, including the arginase (CbARG), ornithine decarboxylase (CbODC), arginine decarboxylase (CbADC), N-carbamoylputrescine amidase (CbNCA), Spermidine synthase (CbSPDS), copper binding diamine oxidase (CbCuAO) to overcome the V toxicity. The polyamines, including the Spm, Spd, and Put, induced with Si about 41.

Integrated physiological, transcriptomic, and metabolomic investigation reveals that MgO NPs mediate the alleviation of cadmium stress in tobacco seedlings through ABA-regulated lignin synthesis.

The harmful influence caused by cadmium (Cd) to agriculture is severe and enduring. Efforts to reduce the damage by Cd to crop is an important topic. In this study, we investigated the effect of MgO NPs on tobacco seedlings' growth under Cd stress and explored its mechanism.

Effect of saliva on accuracy of digital dental implant transfer using two different materials of intraoral scan bodies with different exposed lengths.

Background: The accuracy of digital implant transfer is currently under investigation in relation to the effect of saliva, scan body material, and exposed length.

Methods: Six completely edentulous casts with four implant fixtures were fabricated. The four implant fixtures in each cast were placed below the crest of the ridge of the casts by 1.

Effect of soft tissue thickness on accuracy of conventional and digital implant impression techniques.

Background: Placing implants deep sub-gingivally may affect the accuracy of implant impression techniques and the fit of final restoration.

Purpose: The aim of this in-vitro study was to evaluate the effect of soft tissue thickness on accuracy of conventional and digital implant impression techniques.

Methods: Four parallel implant analogues (A, B, C, D) placed in each of two epoxy resin models representing edentulous mandible covered by flexible polyurethane material with two different thickness two mm and four mm.

The senomorphic impact of astaxanthin on irradiated rat spleen: STING, TLR4 and mTOR contributed pathway.

Objectives: Exposure of spleen tissues to ionizing radiation during radiotherapy can induce cellular stress and immune-dysfunction leading to cellular senescence.

Introduction: The process of a cancerous development is facilitated by the accumulation of senescent cells. This justifies the incorporation of anti-senescent medications during splenic irradiation (SI).

Impact of iron sulfate (FeSO) foliar application on growth, metabolites and antioxidative defense of Luffa cylindrica (Sponge gourd) under salt stress.

Salt stress is becoming a major issue for the world's environment and agriculture economy. Different iron [Fe] sources can give an environmentally friendly alternative for salt-affected soil remediation. In this study the effects of Iron sulfate on Luffa cylindrica (Sponge gourd) cultivated in normal and saline water irrigated soil were examined.

Improving maize yield and drought tolerance in field conditions through activated biochar application.

Amidst depleting water resources, rising crop water needs, changing climates, and soil fertility decline from inorganic modifications of soil, the need for sustainable agricultural solutions has been more pressing. The experimental work aimed to inspect the potential of organically activated biochar in improving soil physicochemical and nutrient status as well as improving biochemical and physiological processes, and optimizing yield-related attributes under optimal and deficit irrigation conditions. Biochar enhances soil structure, water retention, and nutrient availability, while improving plant nutrient uptake and drought resilience.

What Keeps Night Owls Well During the Week? Sleep Onset Consistency as a Moderator Between Morningness-Eveningness and Adolescent Development.

Objectives: A preference for eveningness - one's perception of being most alert later in the day - is associated with negative developmental outcomes in adolescence. Sleep onset consistency is protective against such outcomes. Toward a more nuanced understanding of relations between sleep-wake processes and adolescent development, we examined weeknight sleep onset consistency as a moderator of relations between eveningness and multiple indicators of development.

Corresponding Changes in Sleep and Discrimination: A Three-year Longitudinal Study Among Ethnically/Racially Diverse Adolescents.

Although research has established the immediate, detrimental impact of discrimination on sleep, how changes in experiences of discrimination may be related to changes in sleep duration over multiple years is less clear. This three-year longitudinal study investigated: (1) intercept-only and linear trajectories of sleep and everyday discrimination across three years of high school; (2) ethnic/racial differences in these trajectories; and (3) the associations between changes in sleep and changes in everyday discrimination. The sample consisted of ethnically/racially minoritized adolescents from five northeast U.